KEGG   Chlamydophila caviae: CCA00559Help
Entry
CCA00559          CDS       T00125                                 

Gene name
trpB-1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cca  Chlamydophila caviae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCA00559 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCA00559 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCA00559 (trpB-1)
Enzymes [BR:cca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCA00559 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642703..643941
Genome map
AA seq 412 aa AA seqDB search
MYTCDTCEEDLDLSLDLGETYEELETYGGQYVPLELVKPLEDLDRSYEQLKKDPQFRETF
HHILKNYAGRPTPLTEVKNFSRAINGPRIFLKREDLLHTGAHKINNVLGQCLIAKFQGKT
RVVAETGAGQHGVALAAAAAYLGMECVIFMGETDINRQKPNVDRIRVLGAEVVSVKRGNS
GLKEAVDAAIEDFIFKHDHTHFCIGSALGPYPYPKIVRDFQSVISLEVKSQIKEYTDRDP
DILIACVGGGSNAIGFFHHFIPNTKVKLVGVEGGGLGVESGKHAARFATGKPGVVHGFHS
YVLQDEDGNCADTYSISAGLDYVSVGPTHAEMHESGRAQYTYATDDEALEAFRLLSKTEG
IIPALESSHALAHMIKIAPSLDKDTIAIVNLSGRGDKDLSQIIDLDKRKKHS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtatacttgtgatacttgtgaggaagatttagacctttcattagatttaggtgaaact
tatgaagaactcgagacctatgggggacaatatgttccactagaactcgttaagcccttg
gaagatctggaccggagctatgaacaattaaaaaaagatcctcaatttcgagaaaccttc
caccatattttaaaaaattacgcagggagaccaacgcctttaacagaggtcaaaaatttt
tctagagccatcaatggcccacggatctttttaaaaagagaggatcttctacatacagga
gctcataaaatcaataacgtcttaggccaatgtcttatagccaagtttcaagggaaaacc
cgtgttgtggcagagactggcgccggacaacacggagttgctcttgcagcagcagcagca
tatttaggcatggaatgtgtgattttcatgggggaaacggatatcaatagacaaaagccc
aatgtagacagaatacgtgtcttgggagcagaggttgtttccgtgaaaagaggaaattcc
ggccttaaagaagctgtagatgccgctatcgaagattttatttttaaacatgaccacacg
catttttgcataggatctgcgttaggcccctatccctacccgaagattgtgcgggatttt
caatctgtgattagcttggaggtcaaaagccaaatcaaagagtatacggatcgagatcct
gatattctgattgcctgtgtaggaggaggatccaatgctataggtttttttcatcatttt
attccaaatacaaaggtgaaacttgtaggcgtagagggaggtggtcttggagtcgaatct
gggaaacatgcggcaagatttgccacagggaagcctggcgtggttcatggttttcattcg
tatgtactccaagacgaggacgggaattgtgcagacacttactctatctctgcaggatta
gattacgtaagtgttggcccaacacatgcagaaatgcatgaatctggacgtgctcaatat
acctatgcaacggatgatgaggctttagaagctttccgtcttctatcaaagacagaaggt
atcattccagctttagaatcttctcatgccttggctcatatgataaaaatagctccttct
ctagataaggatacgattgccattgttaacctttcaggaagaggagataaagacctatca
caaattatagacctcgacaaaagaaaaaaacattcttag

DBGET integrated database retrieval system