KEGG   Chlamydophila caviae: CCA00564Help
Entry
CCA00564          CDS       T00125                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cca  Chlamydophila caviae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCA00564 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCA00564 (trpC)
Enzymes [BR:cca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CCA00564 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649147..649968
Genome map
AA seq 273 aa AA seqDB search
MQLAHHLTNIIAYKKQEVERLKEEVSSQKNHYLSQILKQNHLQKEQFATALKEPGLSIIG
EIKRQSPTRGKIRSIDSPADLALKYCCGGASAISVLTDTQGFGGSFLDMQQVNQKLQSQY
SHVSVLRKDFILHPLQLAEAIFFGAHAVLLIVSVVGENLKFLIQEAQRLGLEVLTEIHDL
SELELALEAEAPIIGVNHRNLQTFEIDLNLSEILKPFIPPQIITVAESGIHHPTQAKRMR
ELGFDAILVGEALVSSKDPSLLIKQMKGEENES
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagctcatcatttaacaaacattattgcttataaaaaacaagaagtagaacgg
ctcaaagaagaagttagctcacagaaaaatcattatctgagtcaaattctaaagcaaaat
cacttacaaaaagagcagtttgccacagctctaaaggaaccgggtttatccattattggt
gaaataaaaagacagtctccaacacgtggaaaaattagaagtatagatagtccagcagat
cttgcattaaaatattgttgtggaggggcctctgctatttcagttcttactgatactcaa
ggctttggcggatcttttttagatatgcaacaggtaaatcaaaaactccaatcacaatac
tctcatgtttctgtattgagaaaagatttcatcctacatcctttacaactagccgaagct
attttcttcggagcacatgctgttcttttaatcgtgagcgttgttggagaaaatttaaaa
tttctcatacaagaagcccagagattaggtttagaagttttaaccgaaattcatgatttg
tcagaacttgagttagctttagaagcagaagctcccattattggggttaaccaccgcaat
cttcaaacttttgaaatcgatctcaatctatccgagattctaaaaccctttatccctcct
cagatcattactgtagctgaatcaggaatccatcaccctacacaagccaaacggatgcgc
gagcttggatttgacgctattttggtcggagaagcccttgtgagctctaaagatccttct
ttgttaattaaacaaatgaaaggagaagaaaatgaaagttaa

DBGET integrated database retrieval system