KEGG   Chlamydophila caviae: CCA00567Help
Entry
CCA00567          CDS       T00125                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cca  Chlamydophila caviae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCA00567 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCA00567 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCA00567 (trpA)
Enzymes [BR:cca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCA00567 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651743..652516
Genome map
AA seq 257 aa AA seqDB search
MNRIETAFKNTKPFIGYLTGGDGGFDYSVACAHALIRGGVDILEIGFPFSDPVADGPIIQ
KAHTRALEEKTDSTTILEIAKALRETSNIPLVLFSYYNPLLQKGPQYLHQLKAAGFDAVL
IVDLPIPQHANESEPFFQALIEAKLFPIVLATPSTREERLLQIRKLAKGFLYYVSQKGTT
GIRSKLSDDFSTQIARLRCYFQIPIVAGFGIANRASAAAALKHADGIVVGSAFVEKLEKK
ISPEELTTFAQSIDPRQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattgaaacagcatttaaaaacacaaaaccctttattggatatttgacagga
ggggatggtggatttgactatagtgttgcatgcgctcacgctttaattcggggaggtgtt
gatatcttagaaatagggttccctttttcagatcccgttgcagatggtcctataatccaa
aaggctcacacaagagcattagaagaaaagaccgactctacaaccattttagaaatcgca
aaagctctacgtgaaacctctaatattcctttggtgttatttagctattataacccgctt
ttgcaaaaaggtccccagtatttgcatcagttaaaagcagcaggatttgatgctgtttta
attgtagatctacccattcctcagcatgcaaatgaatctgagcccttctttcaagcttta
atcgaagctaagctgttccccatagtattagctacaccttccacacgtgaagaacggtta
ttacaaatcagaaagttagcaaaaggttttctctattacgtttctcagaaaggaactaca
ggaataagaagcaagctttctgatgatttttctacacaaatagcgagattacgctgctat
tttcaaattcctattgttgctggatttggcatagccaaccgagctagtgcagcagcagct
ttaaaacatgctgatggcattgttgtaggttctgcttttgtggagaaattagaaaagaaa
atatctcctgaagaacttacaacatttgctcaatctatagatccccgtcagtaa

DBGET integrated database retrieval system