KEGG   Chlamydophila caviae: CCA00650Help
Entry
CCA00650          CDS       T00125                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cca  Chlamydophila caviae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cca03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
742283..744490
Genome map
AA seq 735 aa AA seqDB search
MEKISGKLEGILFEDQDSKETAARIRIPYKGTVIVIKGQFPNSFLQIGMQLHLYGKWSEN
PNLGKYFQVYSCDSLEGRDNRGVVNYLTSKLIKGIGPKITEKIIETFQGETTDILDNQPE
KLIEVPGISQTRCDSLCEQLREQKDLRTTLLFLQQYNIAIHYGVRIYKKYKEHSIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLFAGIQHSLEELQEDGHTCYPLQRLAQ
AVEKLLNQDIPDKLIQTEEIISQIYNMQEKNLLHIQELETVPHVWVKHVYLAEKTVVSDL
KRILFSSRRIRPIDGNKAIQWVEENLNLHLEQKQREAVHACFLEKIHIITGGPGTGKSTI
TKAILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLHHFLKALPDHVIVILIGDVHQLPSIGPGNILKDIINSKKITV
TKLNKIFRQVHDSNIIINAHKVNEGEFPILYSESGRKDFLFFQKEDPQEAVDHIVQLVTQ
FIPKKYHIYPKDIQILAPMKKGILGIHNLNKVLKSALNPKQATLHGKFHSYAIGDKVMQI
RNNYNKEVFNGDIGYISMINFENKRVVVNMEGKYVVYSFSELDDLVLAYATSVHKYQGSE
SPCIVLPIHTSHFMMLYRNLLYTAITRGKQLVILVGTKKAIAIATRNDKVQHRCTGLEQA
LEQLTQPGQETISFS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttccggaaaattagaaggcatactttttgaagatcaagattcaaaggaa
actgctgcgcgcataagaataccctataagggtacggtcatcgttatcaaagggcagttc
cctaactcttttctacaaattgggatgcaactgcatctatatggaaaatggtcagaaaat
cctaatttaggaaaatacttccaagtctacagttgtgattctctagaagggagagataat
cgtggggtagtcaattatcttacctctaaacttatcaagggtatcggtccaaaaatcact
gagaagattattgaaacattccaaggtgaaactactgatatcctggacaatcaaccagaa
aaattaattgaagttccaggaattagccaaacgcgttgtgacagcctctgcgagcaactt
cgcgaacaaaaagatcttagaaccaccctgctcttcctacagcaatataatattgctatt
cactatggcgtaagaatttataaaaaatataaagagcactccatagagaaaatctgtgaa
gatcccttccttctcgctagagagatggaaggaataggatttaaaactgcggatcttatt
gccacgcgcttaggagtgccattaaattcacaaagccgattatttgcaggaatccaacat
tccctggaagaactccaagaagatggtcatacctgttatcccctacaaaggcttgcgcag
gctgtagagaaactcctaaatcaagatatccctgacaaactgatacaaactgaagagatc
atctctcaaatatataacatgcaagaaaaaaaccttttgcatattcaagaattagaaacc
gtaccgcacgtctgggtaaagcatgtttacctggcagaaaagactgtagtttctgattta
aaacggatcttattttcctcgaggagaattcgtcctatagatggcaacaaagctattcaa
tgggttgaggagaatctcaaccttcacctagagcaaaagcaaagagaagctgttcatgca
tgttttttagaaaagattcacattatcactggaggaccaggaacagggaaaagtaccatc
accaaggctatccttaaaatatttgaacaggttacctataaaatcattctcgctgctcct
acagggaaagcagcaaaacgtatgacagagatcacgggaaagcactccgtgactattcat
gctctgttacagtatgattttaaaacacgttcttttcgtaagaattatgaaaatcccata
gactgtgatctcatcatagtcgatgaatcgggaatgatggatacctatctcctacatcat
tttctaaaagcacttcccgatcatgtgattgttatcctcattggagatgtgcatcagcta
cctagtattggccctggaaatatcttaaaagatattatcaattctaaaaaaatcaccgta
accaagctaaataagattttccgtcaggtacatgactcaaacatcattatcaatgcccat
aaagtaaatgaaggagaattccccatactctattctgaatctgggcgtaaggatttctta
tttttccaaaaagaagatcctcaggaagctgtggatcacattgtccaactagttacacaa
ttcattcctaagaaataccatatctatcctaaagatattcagattcttgcccctatgaaa
aaaggcatcttaggaatccataatctcaataaagtattaaagtctgctctaaaccctaaa
caagcaactctccatggtaaatttcattcctatgctattggagataaagttatgcaaatc
cgcaataactataataaagaagtgttcaacggagatattggctatatctccatgatcaac
tttgaaaataagcgtgttgtagtcaacatggaaggaaagtatgttgtctattccttctcg
gaacttgatgatcttgttttagcctacgccacttcagtgcataaatatcaaggaagtgaa
agtccctgtattgtccttcctatacatacatcccactttatgatgctctatagaaatctt
ctttacacagcaattacaagggggaaacagcttgttattctagtgggaacaaaaaaagca
atcgccatagccacaagaaatgataaggtacaacatcgctgtacaggactcgagcaagct
cttgagcagcttacacaacctggacaagaaactatctcattttcataa

DBGET integrated database retrieval system