KEGG   Chlamydophila caviae: CCA00842Help
Entry
CCA00842          CDS       T00125                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cca  Chlamydophila caviae
Brite
Enzymes [BR:cca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CCA00842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(964859..965368)
Genome map
AA seq 169 aa AA seqDB search
MKRWFQGSLIALCLLLTLPCCAAKRRSQHQKDSGKVTVQQVKDSGVQWERYTNAVEQSKK
DHKPIGLFFTGSDWCIWCMKMKDQILNTVEFADYANEHLHMVELDFPQVNNQPEDVQQQN
RALKSKYGVNGLPTLVFIDANGAEKARMGFEYGGGANYVKKIQAALKQK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttggttccaaggaagtttaatagctctctgtttattacttacattgccttgt
tgtgcagcaaaaagacgctctcagcatcaaaaggactccgggaaggtcacagttcaacaa
gtgaaagattcaggagtacaatgggagcgctataccaatgctgttgaacaatctaaaaaa
gatcacaaacctataggtttatttttcacaggttctgattggtgtatctggtgtatgaaa
atgaaagatcagattttaaatactgttgagtttgcagattatgctaatgaacatttgcat
atggtggaattggatttcccacaggtgaataaccaacctgaagatgtgcaacagcaaaac
cgagcattaaaatccaaatatggtgtcaatgggctcccaacgttagttttcattgatgct
aatggagctgagaaagccagaatgggatttgagtatggtggtggcgcaaattatgttaag
aaaatccaagctgctttgaagcaaaaatag

DBGET integrated database retrieval system