KEGG   Chlamydophila caviae: CCA00880Help
Entry
CCA00880          CDS       T00125                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cca  Chlamydophila caviae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCA00880
Enzymes [BR:cca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CCA00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008305..1009573
Genome map
AA seq 422 aa AA seqDB search
MKKIIVIGAGISGLATAWWLHRKFPHSELTIIDKAERPGGLIYTDHQKDFSLDLGPKGFL
VRGEGEYTLGLIHDLELQDFLIASDKTAKKRFIHYKGKTRKVSPWTLIKEGLPFAMIKDF
FAPRYTKDSSVYDFLCRHSTTNLIHNVLNPVVTAIRAGHSNVLSAHMAFPTLSQREAKTG
SILRSYLKEPSKKKNKGAPYLASLRPSLGILIDTLVRKIPANWRFSSPISKIDCFPSEVV
VSTANEIFSADLAIYTAPTPLLPSLIDIPGMKQLAKKTPHWDLSCITLGWDKNPPAIPKG
YGMLFADEPPLLGIVYNSEVFPQQMPGKTVISLLLENRWHNEEAYAFSLAAISEYLGITT
KPDVFSLFSPEEGLPQHSVGFLAMKNQLLPSIPHNLKIVGQNFSGPGLNRCVASAYRTVA
AI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcattgtgataggagcagggatttcaggattagcaacagcgtggtggttg
cataggaaatttccccatagcgaacttacaattatagataaggcggagcgtcctggaggt
cttatctatacagatcatcaaaaagatttttccttagatctcgggcctaaaggtttttta
gtacgtggtgagggagaatatactcttggattaattcacgatttagagctgcaagatttc
ctcattgctagtgacaaaacagcgaaaaaacgttttatccactacaaagggaaaacccgt
aaagtctccccatggacattgataaaagagggtttgccctttgctatgatcaaagacttc
tttgcccctcgatacacaaaagatagttctgtttatgattttctatgtcgtcatagcaca
acaaatcttattcataatgtgttaaatcctgttgttacagcaattcgtgcaggacatagt
aatgtactttctgcccatatggcttttcctactctttctcagcgcgaagcaaaaacagga
tctatattacgtagttatctaaaagaaccttcgaagaaaaaaaataagggagctccttat
cttgcctcgctacgcccgagtctaggaattctcattgatactttagtaaggaaaatccct
gctaattggaggttttcttcacctatcagtaagatcgactgtttcccttctgaagttgta
gtatcaacagcaaatgaaatattctcagcagatttagcaatttatacagctccgacacca
ttactcccctctcttattgatattcctggtatgaaacagctcgctaagaaaacacctcat
tgggatctttcctgtataaccctaggatgggataagaatccccctgcgattccgaaaggc
tatgggatgctctttgctgatgagcctcctttacttggcattgtctataatagtgaagtc
tttccccagcaaatgccagggaaaactgtgatttcattattattagaaaatcgctggcat
aacgaagaagcttatgctttttctttagcagcaatttctgaatatttaggaattactaca
aagcctgatgtcttctcattattctctccagaagaaggactcccccagcatagcgtagga
tttttagcaatgaaaaatcagttgcttccctctattcctcataatttaaaaatcgtaggg
cagaatttttcaggaccaggattaaacagatgtgtcgcttcagcctatcgtaccgtcgct
gctatctaa

DBGET integrated database retrieval system