KEGG   Chlamydophila caviae: CCA00929Help
Entry
CCA00929          CDS       T00125                                 

Gene name
nth
Definition
endonuclease III
Orthology
K10773  
endonuclease III [EC:4.2.99.18]
Organism
cca  Chlamydophila caviae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cca00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CCA00929 (nth)
Enzymes [BR:cca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CCA00929 (nth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1078324..1078968
Genome map
AA seq 214 aa AA seqDB search
MENKTLIKNFIISTLNDLFPNPKPSLTGWETPFQLLVAILLSGNSTDKAVNSVTPELFSA
APDAQALAKLPLDKLYFIISPCGLGKRKAAYLHDLSKIISEKYRGEPPASLELLTKLPGV
GRKTASVFLGIIYNMATFPVDTHILRLAQRWGISNKRSPSAAEKDLVRFFGDMNSPKLHL
QLIYYARNYCPALHHDVNTCRICSHLRDLSRKTN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaataaaactcttattaaaaattttatcatttctacattaaacgatctcttccca
aatccgaagccatctttaacggggtgggaaactccatttcagctactcgttgctattttg
ctttcagggaactctaccgataaggctgtaaattctgtaacaccggaattattttcggca
gcacctgatgcgcaagcattagcaaaacttcccttagacaagttatactttattatttct
ccttgtggccttggcaagagaaaggctgcatatcttcacgatttatcaaaaatcatttca
gaaaaatatcgtggcgaacccccagcttctttggaattgttaactaaattacctggagtg
gggagaaaaacagcatccgtctttcttggaattatttacaatatggcaaccttcccagta
gatacacatatcttgagactagcccaacgttggggcatctctaataagcggagcccttca
gcagcagaaaaagatcttgtcaggttctttggagatatgaattctccaaaacttcattta
caactcatctactacgccagaaactactgtccggctctccatcatgatgtgaatacgtgc
aggatatgctcgcacttaagagatctctctagaaaaacaaactaa

DBGET integrated database retrieval system