KEGG   Cajanus cajan (pigeon pea): 109809420Help
Entry
109809420         CDS       T04868                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109809420
   00500 Starch and sucrose metabolism
    109809420
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109809420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 566 aa AA seqDB search
MTISTIFLLTLFSVIYGSGATHHLFINLQTLSSDYSSNQPYRTAYHFQPPKNWINDPNGP
LRYGGLYHLFYQYNPKGAVWGNIVWAHSVSKDLVNWAPLDPAIFPSQPSDINGCWSGSAT
LLHGNKPVILYTGIDPMNHQVQNLAQPKNLSDPFLREWVKTPKNPLMAPTSANKINSSSF
RDPTTAWLGKDGHWRVLVGSKRRTRGMALLYISKDFFNWVQAKHPLHSTLGSGMWECPDF
FPVLNSGQLGVDTSVNGDYVSHVLKVSLDDKKHDYYMIGSYNAAKDVFVPDEGLNSEFVL
RYDYGKYYASKTFFDDGKKRRVLLGWVNESSSVADDIKKGWSGIHAIPRAIWLHKSGKQL
VQWPVVEIEKLRANPVNLAPKLIKGGQLVQINGVTATQADVEISFQVSKLGKAEVLGYLT
DPQILCSKKGSAVKSGLGPFGLLVFASEGLQEYTSVFFRIFRYQHKNLVLLCSDQSRSSL
NKNNDLTTYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAINDKAKI
YAFNNGTSDVNISRLSAWSMKKAHIH
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactatctctactattttccttttgactctcttttctgtgatttatggcagtggtgcc
acgcatcaccttttcataaatcttcagactctttcttctgattattcctccaatcaacct
tacagaactgcctatcacttccaaccccccaagaattggataaatgatcccaatgggcca
ttgagatatggaggactttatcacctgttctaccaatacaaccctaaaggtgcagtttgg
ggaaacatcgtgtgggcccattcagtgtcaaaggatctggtgaactgggccccactggat
cctgccatctttccatctcaaccgtccgatatcaatggttgttggtcaggatcagccaca
ctgcttcatgggaacaaacccgtcattttgtacactggaattgacccaatgaaccaccag
gtccaaaacctggcccagcccaaaaacttgtctgatccatttctcagggaatgggtcaag
accccaaaaaatcctctaatggcacccactagtgccaacaagatcaattcaagttcattt
agggaccccaccactgcttggctaggaaaagatggacattggagagtgcttgttgggagc
aagagaaggactaggggaatggcacttttgtatataagcaaagatttctttaattgggtt
caagccaaacaccccttgcattcaaccctaggaagtggaatgtgggagtgccctgatttt
tttcctgttttgaatagtggccaattgggtgttgacacgtcagtgaatggtgattatgta
agccacgtgcttaaggtcagtttggatgacaagaaacatgattactacatgattgggagt
tacaatgctgccaaggatgtgtttgtcccggatgaggggttgaatagtgaatttgttttg
agatatgattatgggaaatactatgcctcaaaaactttctttgatgatgggaagaagaga
agggttttgcttgggtgggtcaacgaatcctctagtgttgctgatgatatcaagaaagga
tggtctggaattcacgcaattccaagggctatctggctgcataaatctggtaaacagttg
gtgcagtggccagtggtggaaattgaaaagctgcgtgcaaatccagtcaacttggcaccc
aaactgataaaaggaggccaattggttcaaattaacggtgtcacagcaacacaggctgac
gttgaaatttcatttcaagtgagcaagttgggaaaggctgaagtcttgggctatttgacg
gacccccaaattctgtgtagcaaaaagggttcagctgttaaaagtgggctgggcccattt
ggtcttctagtttttgcttcagagggattgcaagaatacacatcagttttcttcagaata
ttcagataccaacacaaaaatttggtgctgttgtgcagtgaccaaagcaggtcttcctta
aacaaaaacaatgatttgaccacttatggaacttttgtggacgtggaccctcttcacgag
aagctatcattgagaaccttgattgatcattctgtagtagagagttttggaggagaagga
agggcttgcatcacagccagagtttatcccacattggcaatcaatgataaagcaaaaatt
tatgctttcaataatggcacttctgatgtcaacatctcaagactaagtgcttggagcatg
aagaaagcacacatacattga

DBGET integrated database retrieval system