KEGG   Castor canadensis (American beaver): 109695148Help
Entry
109695148         CDS       T04791                                 

Gene name
Mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
ccan  Castor canadensis (American beaver)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    109695148 (Mgll)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109695148 (Mgll)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    109695148 (Mgll)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109695148 (Mgll)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S33
   109695148 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 313 aa AA seqDB search
METGLEDPSTMPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYDDLAQMLMRLNLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDMVQKD
HPELPVFLLGHSMGGAIAILTAAERPGHFSGMVLISPLVIASPESATTFKVLAAKVLNLV
LPNMSLGPIDSSVLSRNKTEVDLYNSDPLICHAGLKVCFGIQLLNAVSRVERALPKLTVP
FLLLQGSADRLCDSKGAYLLMDSARSQDKTLKIYEGAYHVLHKELPDVTRSVFHEINMWV
SQRISMAGARSPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagggcttgaagacccatccacaatgccagaggaaagttctcccagaaggacc
ccacagagcgttccataccaggatctaccccacctggtcaacgcggacggacagtacctc
ttctgcaggtactggaagcccaccggcacacccaaggctctcatctttgtgtcccacggt
gctggggagcactgtggccgctatgatgatctggctcagatgctgatgaggctgaacctg
ctggtgttcgcccacgaccatgttggccacggacagagtgagggggagaggatggtggtg
tctgactttcacgtcttcgtcagggatgtactgcagcatgtggacatggttcagaaggac
caccccgagctccctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagagaggcccggccacttctctggcatggtcctaatttcacctctggtcatc
gccagccccgaatcagcaacaactttcaaggtccttgctgcaaaagtgctcaacctcgtc
ctgccaaacatgtccctggggcccatcgactccagtgtgctatcccggaacaagacagag
gttgacctttacaactcggaccccctcatctgccacgcggggctgaaggtgtgtttcggc
atccagctgctcaatgccgtctcgcgggtggagcgtgccctccccaagctgaccgtgccc
ttcctgctgctgcagggctctgctgaccgcctgtgcgacagcaaaggggcctacctgctc
atggactccgccaggagccaggacaagacgctcaagatctatgaaggtgcctaccacgtt
ctccacaaggagcttcctgacgtgacccgttccgtcttccacgaaataaacatgtgggtc
tctcagaggatatccatggcgggagctaggtccccaccctga

DBGET integrated database retrieval system