KEGG   Clostridium cellulovorans: Clocel_0052Help
Entry
Clocel_0052       CDS       T01294                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ccb  Clostridium cellulovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clocel_0052
DNA repair and recombination proteins [BR:ccb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Clocel_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
90966..91562
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPGIGYKTAQRLTLHVLNLPKEEVSEFAEALVKARGTIKYCSI
CGNYTDTDPCSICSNPNRENSIICVVEEPKDIMAVEKVRDFNGTYHVLHGTISPMAGRGP
NDINLKQLVSRMKDNIKEIIVATNANVEGEATAMYISKILKPFDVKVTRIAHGLPMGGDL
EYADEITLAKALEGRKEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggaattttatcctgttgccatagaaaagttaatagaagagtttgcaaagttacctggc
ataggatataaaactgcacagagattaacattgcacgtattaaacttgccaaaggaagag
gttagtgaatttgctgaagccttagttaaagcaagagggactataaagtattgttctatt
tgtgggaattatacagatacagatccttgttcaatttgttcaaacccaaatagagagaat
agtattatttgtgtagtagaagagccaaaggatataatggcagttgaaaaagttcgagat
tttaatggaacttatcatgttcttcatggcactatatctccaatggctggcagaggacct
aatgacataaatcttaagcagcttgtatcacgaatgaaggataacataaaggaaataatc
gtagctactaatgccaatgttgaaggtgaagctactgctatgtatatatccaaaatacta
aagccttttgatgttaaggtaactagaatagcgcatggtcttcctatgggtggagattta
gaatatgctgatgaaataacattagctaaagcgttagaaggaagaaaagaaatctaa

DBGET integrated database retrieval system