KEGG   Clostridium cellulovorans: Clocel_0052Help
Entry
Clocel_0052       CDS       T01294                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ccb  Clostridium cellulovorans
Pathway
ccb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clocel_0052
DNA repair and recombination proteins [BR:ccb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Clocel_0052
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Clocel_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Toprim_2 HHH_8 IMS_HHH Cdd1
Motif
Other DBs
NCBI-ProteinID: ADL49841
JGI: Clocel_0052
UniProt: D9SMQ6
Position
90966..91562
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPGIGYKTAQRLTLHVLNLPKEEVSEFAEALVKARGTIKYCSI
CGNYTDTDPCSICSNPNRENSIICVVEEPKDIMAVEKVRDFNGTYHVLHGTISPMAGRGP
NDINLKQLVSRMKDNIKEIIVATNANVEGEATAMYISKILKPFDVKVTRIAHGLPMGGDL
EYADEITLAKALEGRKEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggaattttatcctgttgccatagaaaagttaatagaagagtttgcaaagttacctggc
ataggatataaaactgcacagagattaacattgcacgtattaaacttgccaaaggaagag
gttagtgaatttgctgaagccttagttaaagcaagagggactataaagtattgttctatt
tgtgggaattatacagatacagatccttgttcaatttgttcaaacccaaatagagagaat
agtattatttgtgtagtagaagagccaaaggatataatggcagttgaaaaagttcgagat
tttaatggaacttatcatgttcttcatggcactatatctccaatggctggcagaggacct
aatgacataaatcttaagcagcttgtatcacgaatgaaggataacataaaggaaataatc
gtagctactaatgccaatgttgaaggtgaagctactgctatgtatatatccaaaatacta
aagccttttgatgttaaggtaactagaatagcgcatggtcttcctatgggtggagattta
gaatatgctgatgaaataacattagctaaagcgttagaaggaagaaaagaaatctaa

DBGET integrated database retrieval system