KEGG   Clostridium cellulovorans: Clocel_0069Help
Entry
Clocel_0069       CDS       T01294                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccb  Clostridium cellulovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
118478..119518
Genome map
AA seq 346 aa AA seqDB search
MNYQLLLRELCSENAPSGLEFKLHPIMEKNFGYIKDLEISKDENYNLYINKKGKRNGTIM
IMAHSDEISLVITEVIEGGFLRFKAIGMDANILLGQEVAIHGCEVINGVIGGIPKSKTDD
NILKKAVVTSDLFIDTGYPKEYLEEVIKIGDRATLIGEYKNLLRNTISSKAIDDRAGILS
MLICAQELKEHELDVVFVCSCQEELGHRGAKMASYKVKPNLAIAIDVTFDNGEFGDRDRE
NKLGNGPIICIGPNNHPRMIKKLKEVARKYYIPFGVEVEPGNTGSDAWDIQVSRGGIPTV
LVSIPIKYMHTSVETANLGDIKNTGRLVARFIEEIKLLDLEELTCF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcagttattactaagagaactgtgtagtgaaaatgcaccatcaggattggaa
tttaagttacatccaattatggaaaagaattttggatatattaaggatttagagatcagt
aaagatgagaattataatctttatataaataaaaaaggaaagcgtaatggtacaataatg
attatggctcactctgatgagatttccttagttattacagaagtgattgagggagggttt
ttacgttttaaagctataggtatggacgctaatatactattaggacaagaagtggctatt
catggatgtgaagttataaacggtgttataggtggaattccaaagagcaagactgatgac
aacattttgaaaaaagcagtagtaacatcagacctttttatagatacaggatatcctaaa
gaatatcttgaggaagttattaaaataggagatagagcgactttaattggagaatataaa
aacttactgagaaatacaatctctagtaaagcaatagatgatagagcaggtattttatcg
atgcttatatgtgctcaggaacttaaggaacatgagttagatgtggtttttgtatgttca
tgccaagaagaacttggacataggggagcgaaaatggcatcgtataaagtgaaaccaaac
cttgcaatagctatagatgtaacctttgataatggtgaatttggagacagggacagggaa
aataagttaggcaatggtcccattatttgtattggtcctaataatcacccaaggatgata
aagaaacttaaggaagtagcaaggaaatattatattccttttggagtggaagtagagcct
gggaatacaggatctgatgcttgggatattcaagtttcaagaggaggtattccaacagta
ttagtatcaataccaataaaatatatgcatacatccgtagaaacagcaaatttgggggac
ataaaaaacacaggaagattagtagctagattcatagaagaaattaaacttctggatttg
gaggaattaacatgcttttag

DBGET integrated database retrieval system