KEGG   Clostridium cellulovorans: Clocel_0237Help
Entry
Clocel_0237       CDS       T01294                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocel_0237
   01230 Biosynthesis of amino acids
    Clocel_0237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_0237
  Energy metabolism
   00680 Methane metabolism
    Clocel_0237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocel_0237
Enzymes [BR:ccb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Clocel_0237
Exosome [BR:ccb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Clocel_0237
  Exosomal proteins of melanoma cells
   Clocel_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
326103..326657
Genome map
AA seq 184 aa AA seqDB search
MITNIYFVRHANSSYTPDELNRPLSENGVKDAQRVTELLSHENISKVISSPYKRAIQTVE
GVSNHFGLSISIDEGFRERKLAEGAVTNFDEVILKYWENFDFCIHGGETAYDAQHRGVES
LKNVLNRYCGENIVIGTHGNIMVIIMNYYDKKYNYVFWKDLNMPDIYKLIFKDNNLVGVE
HIWS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgataactaatatatattttgttagacatgctaattcatcatatactcctgatgaatta
aataggccattatctgaaaatggggtaaaggatgcccaaagggtaacagaattactatca
catgaaaatataagtaaggttatatcaagtccgtataaacgtgctattcaaacggttgaa
ggcgtatcaaatcatttcggattatctatttcaatagatgaaggatttagagaaagaaaa
cttgctgagggagcagttacaaattttgatgaagtaattttgaagtattgggaaaacttc
gatttctgcattcacggaggtgaaacagcttacgatgcccaacatagaggtgtagagtct
cttaaaaatgttttaaatagatattgcggagaaaatattgttattggaactcatggaaat
attatggtgataataatgaattattatgataaaaaatataattacgttttctggaaagat
ttgaatatgccagatatatataaattaatctttaaagataataatttagtcggtgtagaa
catatttggtcatga

DBGET integrated database retrieval system