KEGG   Clostridium cellulovorans: Clocel_0237Help
Entry
Clocel_0237       CDS       T01294                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00010  Glycolysis / Gluconeogenesis
ccb00260  Glycine, serine and threonine metabolism
ccb00680  Methane metabolism
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
ccb01120  Microbial metabolism in diverse environments
ccb01130  Biosynthesis of antibiotics
ccb01200  Carbon metabolism
ccb01230  Biosynthesis of amino acids
Module
ccb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_0237
  Energy metabolism
   00680 Methane metabolism
    Clocel_0237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocel_0237
Enzymes [BR:ccb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Clocel_0237
Membrane trafficking [BR:ccb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Clocel_0237
Exosome [BR:ccb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Clocel_0237
  Exosomal proteins of melanoma cells
   Clocel_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADL50021
JGI: Clocel_0237
UniProt: D9SPH2
Position
326103..326657
Genome map
AA seq 184 aa AA seqDB search
MITNIYFVRHANSSYTPDELNRPLSENGVKDAQRVTELLSHENISKVISSPYKRAIQTVE
GVSNHFGLSISIDEGFRERKLAEGAVTNFDEVILKYWENFDFCIHGGETAYDAQHRGVES
LKNVLNRYCGENIVIGTHGNIMVIIMNYYDKKYNYVFWKDLNMPDIYKLIFKDNNLVGVE
HIWS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgataactaatatatattttgttagacatgctaattcatcatatactcctgatgaatta
aataggccattatctgaaaatggggtaaaggatgcccaaagggtaacagaattactatca
catgaaaatataagtaaggttatatcaagtccgtataaacgtgctattcaaacggttgaa
ggcgtatcaaatcatttcggattatctatttcaatagatgaaggatttagagaaagaaaa
cttgctgagggagcagttacaaattttgatgaagtaattttgaagtattgggaaaacttc
gatttctgcattcacggaggtgaaacagcttacgatgcccaacatagaggtgtagagtct
cttaaaaatgttttaaatagatattgcggagaaaatattgttattggaactcatggaaat
attatggtgataataatgaattattatgataaaaaatataattacgttttctggaaagat
ttgaatatgccagatatatataaattaatctttaaagataataatttagtcggtgtagaa
catatttggtcatga

DBGET integrated database retrieval system