KEGG   Clostridium cellulovorans: Clocel_0388Help
Entry
Clocel_0388       CDS       T01294                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00010  Glycolysis / Gluconeogenesis
ccb00030  Pentose phosphate pathway
ccb00051  Fructose and mannose metabolism
ccb00052  Galactose metabolism
ccb00680  Methane metabolism
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
ccb01120  Microbial metabolism in diverse environments
ccb01130  Biosynthesis of antibiotics
ccb01200  Carbon metabolism
ccb01230  Biosynthesis of amino acids
ccb03018  RNA degradation
Module
ccb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_0388
   00030 Pentose phosphate pathway
    Clocel_0388
   00051 Fructose and mannose metabolism
    Clocel_0388
   00052 Galactose metabolism
    Clocel_0388
  Energy metabolism
   00680 Methane metabolism
    Clocel_0388
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Clocel_0388
Enzymes [BR:ccb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clocel_0388
Protein phosphatases and associated proteins [BR:ccb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clocel_0388
Messenger RNA biogenesis [BR:ccb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Clocel_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADL50168
JGI: Clocel_0388
UniProt: D9SQA1
Position
496405..497364
Genome map
AA seq 319 aa AA seqDB search
MKTIGVLTSGGDSPGMNAAIRAVVRTALQNNIRVVGIQRGYSGLINGEITELTRDSVSDI
IQRGGTILKTARSNTFRTEEGRRRAADVLKVFGVEGLVVVGGDGSFMGAKLLSDLGVATI
GLPGTIDNDLAYTDYTIGFDTALNTVIDAVNKLKDTSSSHERASVVEVMGRNCGDIALYS
GLAGGAESIILPEKPFDMDELCRGILEGKMRGKLHNLIMVAEGVGKAEEIAKKIEDITGI
EARVTKLGHIQRGGSPTVADRVLATRMGYRAVELLREGKSARVVGIKNNKIIDLDITEAL
AIESKFDEDLFKIAETISY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccataggtgttttaacaagcggaggagattctccaggaatgaacgcagcgata
agagcagtggtacgtacagcacttcagaataacataagagtagtagggatacaacgagga
tatagtggactaataaatggcgaaattaccgaattaacaagagatagcgtttctgatatt
attcagcgtggaggtacaatccttaaaacagctaggagcaatacctttaggactgaagaa
ggaagaagaagagcagcggatgtgttaaaggtctttggagttgaaggacttgtagtagtt
ggcggtgatggttcctttatgggggctaagcttttatcagacctaggagttgctactata
ggactacctggtactatagacaatgatttggcatatacagattatacaattggcttcgat
acagcattaaatacggtcatagatgctgtgaataaattaaaggatacatctagttctcat
gaaagagcgagtgtcgttgaagtaatgggaagaaattgtggtgacatagctttgtactcc
ggtcttgctggcggtgcagaaagcatcattcttccagaaaaaccttttgatatggatgaa
ctatgcagggggattttagaaggaaaaatgagaggcaaattacataatttaataatggta
gcagaaggtgtcggaaaagcagaagaaatagcaaaaaagatagaagatatcacaggaatt
gaagctagagtcacaaaacttggacacatacaaagaggtggaagtcctacagttgcggat
agagtattagctacaagaatgggatatagagcagttgagttgctacgtgagggaaagtct
gccagagtcgttgggataaaaaataataaaataatagatttagatataacagaagcctta
gcaattgaaagtaaattcgatgaggatctgtttaagattgccgaaacaatttcatactag

DBGET integrated database retrieval system