KEGG   Clostridium cellulovorans: Clocel_0388Help
Entry
Clocel_0388       CDS       T01294                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocel_0388
   01230 Biosynthesis of amino acids
    Clocel_0388
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_0388
   00030 Pentose phosphate pathway
    Clocel_0388
   00051 Fructose and mannose metabolism
    Clocel_0388
   00052 Galactose metabolism
    Clocel_0388
  Energy metabolism
   00680 Methane metabolism
    Clocel_0388
Enzymes [BR:ccb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clocel_0388
Protein phosphatases and associated proteins [BR:ccb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clocel_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
496405..497364
Genome map
AA seq 319 aa AA seqDB search
MKTIGVLTSGGDSPGMNAAIRAVVRTALQNNIRVVGIQRGYSGLINGEITELTRDSVSDI
IQRGGTILKTARSNTFRTEEGRRRAADVLKVFGVEGLVVVGGDGSFMGAKLLSDLGVATI
GLPGTIDNDLAYTDYTIGFDTALNTVIDAVNKLKDTSSSHERASVVEVMGRNCGDIALYS
GLAGGAESIILPEKPFDMDELCRGILEGKMRGKLHNLIMVAEGVGKAEEIAKKIEDITGI
EARVTKLGHIQRGGSPTVADRVLATRMGYRAVELLREGKSARVVGIKNNKIIDLDITEAL
AIESKFDEDLFKIAETISY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccataggtgttttaacaagcggaggagattctccaggaatgaacgcagcgata
agagcagtggtacgtacagcacttcagaataacataagagtagtagggatacaacgagga
tatagtggactaataaatggcgaaattaccgaattaacaagagatagcgtttctgatatt
attcagcgtggaggtacaatccttaaaacagctaggagcaatacctttaggactgaagaa
ggaagaagaagagcagcggatgtgttaaaggtctttggagttgaaggacttgtagtagtt
ggcggtgatggttcctttatgggggctaagcttttatcagacctaggagttgctactata
ggactacctggtactatagacaatgatttggcatatacagattatacaattggcttcgat
acagcattaaatacggtcatagatgctgtgaataaattaaaggatacatctagttctcat
gaaagagcgagtgtcgttgaagtaatgggaagaaattgtggtgacatagctttgtactcc
ggtcttgctggcggtgcagaaagcatcattcttccagaaaaaccttttgatatggatgaa
ctatgcagggggattttagaaggaaaaatgagaggcaaattacataatttaataatggta
gcagaaggtgtcggaaaagcagaagaaatagcaaaaaagatagaagatatcacaggaatt
gaagctagagtcacaaaacttggacacatacaaagaggtggaagtcctacagttgcggat
agagtattagctacaagaatgggatatagagcagttgagttgctacgtgagggaaagtct
gccagagtcgttgggataaaaaataataaaataatagatttagatataacagaagcctta
gcaattgaaagtaaattcgatgaggatctgtttaagattgccgaaacaatttcatactag

DBGET integrated database retrieval system