KEGG   Clostridium cellulovorans: Clocel_0516Help
Entry
Clocel_0516       CDS       T01294                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ccb  Clostridium cellulovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
637215..638693
Genome map
AA seq 492 aa AA seqDB search
MRKSGVLLPVASLPSKYGIGAFSKNAYKFIDQLKAAGQSYWQILPLGPTGYGDSPYQSFS
TFAGNPYFIDLEELIAEGYLTEEECESYDFGDNERYIDYEKIYLSRFKILKIAFGRSNIK
ETEEFQKFIANNAYWLEDYALYMAVKNYFDGVSWIKWDDDIRLRKKSALEKYKSKLEDEI
AFYQFQQFLFNKQWEALKEYANEADIKIIGDIPIYVAFDSADSWAHPELFQFDENGEPIA
VAGCPPDGFSATGQLWGNPLYNWDYHEKTEYKWWVERIAYSFKLYDVVRVDHFRGFDEYY
SIPYGSETAEIGSWEKGPGYEIFKEVRKQLGEVNIIAEDLGFLTESVLKLVEETGYPGMK
VLEFAFDSREESDYLPHNYVKNCIVYTGTHDNETIVGWYKNLNPDDKKLAIDYLDIKDKT
DEDIHWKFIKLALSSVANLAIIPLQDYLGLGNEARINTPSTVGGNWKWRLLEDEITEELV
EKINKVTKLYGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagtggagttttactaccagttgccagtttaccttcaaagtacggaataggt
gcattttctaaaaatgcatataagtttatagatcagttgaaagcagcaggacaaagctat
tggcaaatactgcctttagggcctactggatatggggattcgccatatcaatccttttca
acctttgctggaaatccgtattttattgatttggaagaattaattgctgaaggatattta
actgaagaagaatgtgaatcttatgattttggagataatgaaagatatatagactacgaa
aaaatatacttatctagatttaaaattttaaaaattgcttttggaagaagtaatataaaa
gaaacagaagagtttcaaaagtttattgcaaacaatgcttattggttagaagattatgct
ttatatatggcagtaaaaaactatttcgacggtgtaagttggattaagtgggatgatgat
ataagattaagaaaaaagtctgcacttgaaaaatataaaagcaagcttgaagatgaaatt
gccttttatcaatttcagcaattcttatttaacaaacaatgggaagcattgaaagaatat
gccaatgaagctgatattaagattattggagatattcccatctatgtggcttttgatagt
gcagatagctgggcacatccagagttattccaatttgatgaaaatggagaaccaattgct
gtagcaggctgtccgccagacggtttctctgctacagggcaattgtggggcaaccctctt
tataattgggactaccatgagaaaactgaatataagtggtgggttgaaagaatagcttat
tcctttaagttatatgatgttgtacgtgttgatcatttcagaggctttgacgaatactac
tcaataccttatgggtcagaaacagcagagattggaagttgggaaaaaggtcctggctac
gagatttttaaagaagtacggaagcaattaggtgaagtaaatataatagcagaagattta
ggctttttaacagaaagtgttttgaaacttgttgaggaaaccggttatccaggtatgaaa
gtattagaatttgcttttgattcaagagaagaaagtgattatttacctcataattatgtg
aagaattgtattgtttatactggaacacatgataatgaaacaattgtaggatggtataag
aatttaaatccagatgataagaaattagctattgattatttggacatcaaagataagact
gatgaggatattcattggaaatttataaaactggcactttctagtgtcgcaaacttagca
attataccattacaggattatttaggattaggaaatgaggctagaattaataccccttca
acagtggggggaaattggaaatggcgtttattagaggatgaaattactgaggaattagta
gagaaaataaacaaggttacaaagttatatggaagataa

DBGET integrated database retrieval system