KEGG   Clostridium cellulovorans: Clocel_0516Help
Entry
Clocel_0516       CDS       T01294                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00500  Starch and sucrose metabolism
ccb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clocel_0516
Enzymes [BR:ccb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Clocel_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ADL50291
JGI: Clocel_0516
UniProt: D9SR03
Position
637215..638693
Genome map
AA seq 492 aa AA seqDB search
MRKSGVLLPVASLPSKYGIGAFSKNAYKFIDQLKAAGQSYWQILPLGPTGYGDSPYQSFS
TFAGNPYFIDLEELIAEGYLTEEECESYDFGDNERYIDYEKIYLSRFKILKIAFGRSNIK
ETEEFQKFIANNAYWLEDYALYMAVKNYFDGVSWIKWDDDIRLRKKSALEKYKSKLEDEI
AFYQFQQFLFNKQWEALKEYANEADIKIIGDIPIYVAFDSADSWAHPELFQFDENGEPIA
VAGCPPDGFSATGQLWGNPLYNWDYHEKTEYKWWVERIAYSFKLYDVVRVDHFRGFDEYY
SIPYGSETAEIGSWEKGPGYEIFKEVRKQLGEVNIIAEDLGFLTESVLKLVEETGYPGMK
VLEFAFDSREESDYLPHNYVKNCIVYTGTHDNETIVGWYKNLNPDDKKLAIDYLDIKDKT
DEDIHWKFIKLALSSVANLAIIPLQDYLGLGNEARINTPSTVGGNWKWRLLEDEITEELV
EKINKVTKLYGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagtggagttttactaccagttgccagtttaccttcaaagtacggaataggt
gcattttctaaaaatgcatataagtttatagatcagttgaaagcagcaggacaaagctat
tggcaaatactgcctttagggcctactggatatggggattcgccatatcaatccttttca
acctttgctggaaatccgtattttattgatttggaagaattaattgctgaaggatattta
actgaagaagaatgtgaatcttatgattttggagataatgaaagatatatagactacgaa
aaaatatacttatctagatttaaaattttaaaaattgcttttggaagaagtaatataaaa
gaaacagaagagtttcaaaagtttattgcaaacaatgcttattggttagaagattatgct
ttatatatggcagtaaaaaactatttcgacggtgtaagttggattaagtgggatgatgat
ataagattaagaaaaaagtctgcacttgaaaaatataaaagcaagcttgaagatgaaatt
gccttttatcaatttcagcaattcttatttaacaaacaatgggaagcattgaaagaatat
gccaatgaagctgatattaagattattggagatattcccatctatgtggcttttgatagt
gcagatagctgggcacatccagagttattccaatttgatgaaaatggagaaccaattgct
gtagcaggctgtccgccagacggtttctctgctacagggcaattgtggggcaaccctctt
tataattgggactaccatgagaaaactgaatataagtggtgggttgaaagaatagcttat
tcctttaagttatatgatgttgtacgtgttgatcatttcagaggctttgacgaatactac
tcaataccttatgggtcagaaacagcagagattggaagttgggaaaaaggtcctggctac
gagatttttaaagaagtacggaagcaattaggtgaagtaaatataatagcagaagattta
ggctttttaacagaaagtgttttgaaacttgttgaggaaaccggttatccaggtatgaaa
gtattagaatttgcttttgattcaagagaagaaagtgattatttacctcataattatgtg
aagaattgtattgtttatactggaacacatgataatgaaacaattgtaggatggtataag
aatttaaatccagatgataagaaattagctattgattatttggacatcaaagataagact
gatgaggatattcattggaaatttataaaactggcactttctagtgtcgcaaacttagca
attataccattacaggattatttaggattaggaaatgaggctagaattaataccccttca
acagtggggggaaattggaaatggcgtttattagaggatgaaattactgaggaattagta
gagaaaataaacaaggttacaaagttatatggaagataa

DBGET integrated database retrieval system