KEGG   Clostridium cellulovorans: Clocel_0642Help
Entry
Clocel_0642       CDS       T01294                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
Orthology
K00018  
glycerate dehydrogenase [EC:1.1.1.29]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ccb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ccb00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:ccb00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ccb00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
802307..803263
Genome map
AA seq 318 aa AA seqDB search
MKIVVLDGKVLNPGDLSWDGLKALGDVTIYDRTSKEEMLTRCESADILITNKTPIRKEIL
EKLPTLKYIGVLATGYNIVDVEYATSKNIIVTNIPAYSTDSVVQLIFALLLELCHSVQKH
SDLVKEECWVKCSDFAFWRFPLVELAGKTMGIIGFGSIGIATAKVANAFGMKVMVYTRTI
KEEFKELVTFCSKEELFTNSDVISLSAPLTKETEGIVNKKYLSMMKKTAFLINTSRGPLV
IEQDLANALNNGDIAAAAVDVLSKEPPTKDNPLLTVKNIIITPHIAWATFEARKRLMNIA
IDNVRKFLEGNPVNVVKE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttgttttagatggaaaagttttaaatcctggagatttaagttgggatgga
ttaaaagcattaggagatgttactatttacgatagaacttctaaagaagaaatgttaact
cgttgtgagagtgcagatattttaattacaaataagacacctataagaaaagagatatta
gagaaacttccaacactaaaatatattggggttttggctacagggtataatatcgttgat
gtagagtatgctacgtctaaaaatattatagtaacaaatattccagcttatagtacagat
tctgtagtacaacttattttcgcattgttgcttgaactttgtcattctgtacaaaagcat
agtgatttggtgaaggaagaatgttgggtaaaatgctctgatttcgccttctggagattc
ccgttggtggaacttgcaggaaagacaatgggtataataggctttggtagtataggaata
gctacggcaaaggttgctaatgcttttggtatgaaggtcatggtttatactagaacgata
aaggaagaattcaaagaattagtaaccttttgttcaaaagaagaactgttcacaaattct
gacgttatttccctaagtgcacctttaacaaaggagacagagggaatagtaaataaaaag
tatctttcaatgatgaagaaaacagcttttttaatcaatacttcaagaggaccattagtt
atagaacaggatttagctaatgcattgaataatggagatatagctgcagcggcagtagat
gttctatcaaaggaaccgccaacaaaagataatccattacttacagttaaaaacataata
ataacaccacatatagcctgggccacctttgaagcaagaaagagacttatgaatattgct
atagacaatgtaagaaaatttttagaaggtaaccctgtaaatgtggttaaggaataa

DBGET integrated database retrieval system