KEGG   Clostridium cellulovorans: Clocel_0721Help
Entry
Clocel_0721       CDS       T01294                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocel_0721
   01230 Biosynthesis of amino acids
    Clocel_0721
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_0721
   00051 Fructose and mannose metabolism
    Clocel_0721
   00562 Inositol phosphate metabolism
    Clocel_0721
Enzymes [BR:ccb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clocel_0721
Exosome [BR:ccb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clocel_0721
  Exosomal proteins of bladder cancer cells
   Clocel_0721
  Exosomal proteins of melanoma cells
   Clocel_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
898487..899233
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTVDEAVAYINEFKPLVKDATCDVVLCVPFIALDAAVKAAAGSNIKI
GAQNMHFEESGAFTGEVSPKMLTSIGVDYVVIGHSERRQYFAETDETCNLKVKKAIEHNL
IPILCCGETLEERETDKTEEVIGAQIKADLADVAEADLEKVVIAYEPIWAIGTGKTATDD
QANETIAFIRKTLASLYTQEAADKVRIQYGGSVKPSTIKAQMAKSDIDGALVGGASLLTD
DFAQIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaataatcgcaggaaactggaaaatgaacaaaactgttgacgaagcagtt
gcttatataaatgaatttaaaccactagttaaagatgctacatgtgacgttgttttatgt
gtaccattcatagctttagatgctgctgttaaagctgctgcaggaagcaacatcaaaatt
ggtgctcaaaacatgcactttgaagaaagtggtgctttcacaggagaagtttctcctaag
atgttaacttcaattggagttgactatgtagtaattggacatagtgaaagaagacaatac
ttcgctgaaacagatgaaacttgtaacttaaaggttaaaaaagctatcgaacacaactta
attccaatcctttgctgtggagaaactttagaagaaagagaaactgataaaactgaagaa
gttatcggtgctcaaatcaaagctgacttagcagacgttgcagaagcagacttagaaaaa
gttgttatagcttacgaaccaatctgggctataggaactggtaaaactgctacagacgat
caagctaatgaaacaatagctttcatcagaaaaactttagcttcattatacactcaagaa
gctgctgataaagttagaatccaatacggtggttcagttaaaccttcaacaatcaaggca
caaatggctaagagcgatatcgatggtgctttagttggcggagctagtcttttaactgat
gactttgcacaaatcgtaaactactaa

DBGET integrated database retrieval system