KEGG   Clostridium cellulovorans: Clocel_1020Help
Entry
Clocel_1020       CDS       T01294                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ccb00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1252399..1253820
Genome map
AA seq 473 aa AA seqDB search
MKEIKFPEGFLWGGATAANQFEGAYNEDGKGLSIQDLMPKGIMGPITDEPTEDNMKLIGI
DFYHRYKEDIKLFAEMGFKTFRLSIAWSRIFPNGDDKEPNEKGLQFYDNVFDELAKYGME
PLVTISHYETPLALAKNYDGWVNRKLIGFFENYVRTIFTRYKDKVKYWLTFNEINSALHA
PYMSAGIWTPKEKLSKQDLYQAMHHELVASALAVKVGHEINPEFKIGCMILGVPNYPLTS
MPSDVLKAMEQDRENLFFADIHARGEYPRYMNRVFKENSIEIKMEPGDKEILKHTVDFIS
FSYYMSSCATADPEKNKRGKGNILSGVPNPYLQASEWGWQIDPQGLRYILNQLYDRYQKP
LFIVENGLGAVDQLVTDENGNKTVNDDYRINYLNDHLVQVAEAIEDGVELWGYTTWGCID
LVSASTAELKKRYGFIYVDRNDDGSGTLERYKKKSFYWYKEVISSNGASLKVK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaataaaatttccagaaggctttttatggggaggagcaactgctgctaaccaa
tttgaaggagcatataatgaagacggaaaaggcttatcaatacaagatttaatgccaaag
ggtataatgggaccaataactgatgagccaacagaagacaatatgaagcttatcggtatt
gatttttatcatagatataaggaagatataaagttatttgctgagatgggctttaagacc
tttagattatcaattgcttggtcaagaatattcccaaatggtgatgataaagagccaaac
gaaaaaggcttacagttttatgataatgtctttgatgaattggctaaatacggaatggag
cctttagttacaatttcacattatgaaacaccactggctcttgctaaaaattatgatggc
tgggtaaatagaaagcttataggcttctttgaaaactatgtaagaacaatattcactaga
tataaggataaggtaaaatattggcttacttttaatgaaataaattcagcacttcatgcg
ccttatatgagtgctggaatttggacaccaaaagaaaaattaagcaagcaagatttatat
caagctatgcatcatgaactagttgctagtgcattggcagtaaaagttggccatgaaata
aacccagaattcaaaatcggttgtatgattcttggagtaccaaactatccattaacgtcg
atgccaagtgatgtgcttaaggcaatggagcaagatagagaaaatcttttctttgcagat
attcatgcaagaggagagtatccaagatacatgaacagagtctttaaagaaaacagcata
gaaataaaaatggagcctggtgataaagaaatactaaagcatacagtagatttcatttcc
tttagttactatatgagttcctgtgcaacggcagatccagaaaaaaataaaagaggcaaa
ggtaacattctttcaggagtaccaaacccatatttacaagcatcagaatggggctggcaa
atagacccacaaggtttaagatatatccttaaccaattatatgatagatatcaaaaacca
ttatttattgtggaaaatggtttaggtgctgtggatcaattagttactgatgaaaatggc
aataaaactgtaaatgacgattatagaattaattatttaaacgatcatttagttcaagtt
gcagaagctattgaggatggtgttgagctttggggatacacaacctggggctgtatagac
ttggttagtgcatcaacagcagagcttaaaaagagatatggctttatctatgttgataga
aatgatgatggaagtggtactttagaaagatacaagaaaaagagtttctattggtataaa
gaagttatatctagtaatggagctagtttaaaggtaaaataa

DBGET integrated database retrieval system