KEGG   Clostridium cellulovorans: Clocel_1150Help
Entry
Clocel_1150       CDS       T01294                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccb  Clostridium cellulovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clocel_1150
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clocel_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1390038..1391360
Genome map
AA seq 440 aa AA seqDB search
MNKRLSRGKISLLASVFVTTTFMGGVNVLASTAKTGIRDITSQQVVKEMKVGWNLGNTMD
ATGGETNWGNPLTTHAMIDKVKAAGFNTLRLPITWDGHIGAAPDYAIDATWMNRVEEIAN
YAFDNNMYVIINLHHEDGWLKPYYANEAEVKAKITKVWTQIANRFKDYGDYLIFETMNEP
RPVGAADEWSGGSYENRDMVNRYNLTAVNTIRATGGNNALRHIMVPTLAAAALSTTMNDY
IVPNNDSRVIVSLHMYSPYFFSADLTSQWTTATWGSDADKAALSADFDAVYNKFVKNGRA
VVIGEMGTINKNNLDSRVKHAEYYAKEATVRGITPIWWDNGYCVAGKEQTFGIFNRKNLT
WCCPEVMQAFIRGAGATQTQTSYSLGDVNKDGKVNAIDYAVLKSILLGTNTNVDLSVSDM
NKDGKVNALDLAVLKKMLLS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagattatcacggggaaagatatctcttttagcatcagttttcgttaccaca
acttttatggggggagtaaatgttctcgcatctacagctaagacaggtattcgtgacata
acttctcaacaagttgttaaggaaatgaaggttggttggaacttaggaaatacaatggat
gctacaggaggagaaacaaattgggggaatccattaacaacacatgccatgattgacaaa
gtaaaagcagcaggctttaatactttaaggcttccaataacttgggatggtcatattgga
gcagcaccagattatgctattgatgcaacatggatgaatagagtcgaagaaatagcaaat
tatgcttttgataataatatgtatgttataataaatcttcatcacgaagatggatggctt
aagccttattatgccaatgaggctgaagtaaaagctaaaatcacaaaagtatggacacaa
attgcaaatcgctttaaagattatggggattatctaatttttgaaacaatgaatgaacct
cgtccagtaggcgcagctgatgaatggtctggtggctcctatgaaaatcgagatatggtt
aatagatataatttaacagcggtaaacactattagagctactggtggaaataatgcatta
aggcacattatggttccaactcttgcagcagcagcacttagcacaacaatgaatgattac
atagtaccaaataatgatagcagagttatagtatccttacatatgtattcaccatatttc
ttctctgcagatcttactagtcaatggactacagcaacttggggaagtgatgctgataag
gctgcactaagtgctgactttgatgcagtttataataagtttgttaagaatggaagagct
gtagttattggcgaaatgggaacaatcaataagaataatttagattctagagtgaaacat
gcagaatattatgctaaagaagcaacagttagagggataactcctatatggtgggataat
ggatattgtgttgctggaaaagagcaaaccttcggaatatttaatagaaagaatcttact
tggtgttgtccagaagttatgcaagctttcataagaggagcaggtgccacacaaactcaa
acttcttattcactaggtgatgttaacaaagatggaaaggtaaatgctatcgattatgca
gtgcttaaatcaattcttttaggtacaaatactaacgttgatttatcagtatcagacatg
aataaggatggtaaagtaaatgctttggatttagctgttcttaaaaaaatgcttttaagc
taa

DBGET integrated database retrieval system