KEGG   Clostridium cellulovorans: Clocel_1424Help
Entry
Clocel_1424       CDS       T01294                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ccb  Clostridium cellulovorans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clocel_1424
   00500 Starch and sucrose metabolism
    Clocel_1424
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Clocel_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1753295..1754278)
Genome map
AA seq 327 aa AA seqDB search
MIVCKDGSGDFKTIQEAINSIPDNSNEKVTIYIKDGVYKEKLHITKPYVILIGESTEKTI
ITFDDYANKLFPNGEKYRTFNSYTVFISGDNFTAQNITIENSAGSGDVVGQAVALYVDSD
KAIFKKCKFLGQQDTIFTGPLPPKPIEGNDFGGPMEGKPRRNVRQYFEQCYIEGDIDFIF
GSSTVVFNKCEVFSLDKDKPINGYITAASTPEGLDFGYVFIDCKLTSNAKKETVYLGRPW
RDYAKTAFINCYMGKHIINEGWHNWDKKQAENLVSYVEYNSYGPGATLDKRAQWTKVLSR
ESVAIYSISNVLSGNDNWNPIDSSCEV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttgtaaagatggaagtggagattttaaaacaattcaagaggctataaattct
ataccagataatagtaacgaaaaagttactatttatattaaagatggagtttataaagaa
aagctacatattaccaagccatatgtaatcttaatcggagaaagtactgaaaaaactatt
ataacttttgatgattatgctaacaaactatttcctaacggcgaaaaatatagaaccttt
aattcatatactgtatttatttctggtgacaatttcacagctcaaaatattaccattgaa
aattctgctggtagtggagacgtcgtggggcaagcagtggcattatatgttgatagcgac
aaagctatatttaagaaatgtaaattccttggacaacaagacactatatttactggtcct
cttccccctaagcctatagaaggaaacgattttggtggtcctatggaaggtaaaccaaga
agaaatgttagacaatactttgaacaatgttatattgaaggtgatatagacttcatattc
ggttcttcaacagttgtctttaataaatgtgaagttttttccttagacaaagataaacct
attaatggatatataactgcagcctcaacaccagaaggtttagattttgggtatgtattt
atagattgtaaattaacaagcaatgcaaaaaaagaaacagtgtatctaggacgaccttgg
agagactatgccaaaactgcttttataaattgttatatgggaaaacatataattaacgaa
ggatggcacaattgggataagaaacaagcagaaaatttagttagctatgtagaatacaat
agctatggcccaggagctacactagacaaaagagctcagtggacaaaggtgctatcaaga
gaatcagtagctatttattcgatcagcaacgtactttctggaaacgataattggaatcct
atagattcatcttgtgaagtttaa

DBGET integrated database retrieval system