KEGG   Clostridium cellulovorans: Clocel_1463Help
Entry
Clocel_1463       CDS       T01294                                 

Definition
fructose-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ccb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ccb00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ccb00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ccb00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:ccb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1803202..1805199)
Genome map
AA seq 665 aa AA seqDB search
MSIHKELNELDVEKDLRYLNLLSKEYSTINSVCTEFINLQSILNLPKGTEHFLTDIHGEY
EQFNHVLKNASGVIKRKIEDIFGNTLRQNEKKSLATLIYYPEQKLDIVLKEEENINDWYT
ITLYRLIEICRHVSSKYTRSKVRKALPKDFAYIIEELLHEYPESLDKHGYYGEIVKTIVA
IDRAREFIMALSNLIQRLVIDRLHIIGDIFDRGPGAEIILDTLKNYHSVDIQWGNHDVLW
MGACAGSKACIANVIRISARYSNLDTIEDGYGINLLPLATFALDFYKEDPCTGFFPKFDA
EKNYSVTEIELIAKMHKAIAIIQFKLEGEIINRRPGFNMDDRLLLNKINFEAGTIELDGK
TYKLNDTYFPTIDPKDPYKLLKEEQELVEKLRSSFMNSDKLNKHVRFLFANGSIYLKYNS
NLLYHGCIPMNENGTFKKVRLRDKEYNGKSLLDRLEILAREGYFHEDNPAAKLFGTDIMW
YLWTGPYSPLFGKEKMTTFERYFIDDKKTHIEKKDPYYNFRDKEEVYDNIFSEFGLDPNE
SHIVNGHVPVEKKKGESPIKAKGKLLVIDGGFSKAYQGKTGIAGYTLIYNSFGLQLVSHE
PFQSTEKAIKEETDILSSTVILEHSMVRKKVADTDVGAILQEQIKNLKMLLIAYRTGLIK
EKNSI
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatacataaagaactaaatgaactggatgttgaaaaagatttaagatacttaaat
ttattatctaaggaatattctaccattaattcagtatgtacagaatttattaatcttcag
tccattttaaatctaccaaaaggtactgaacattttctaactgacatccatggagaatac
gaacaattcaaccatgtgctaaaaaatgcatcaggggtaataaaaagaaaaatagaagat
atctttggaaacaccttaagacaaaatgaaaagaagagcctagccaccctaatatattat
cccgaacaaaaactagatatagtattaaaagaggaagaaaatatcaatgattggtatact
atcaccttatatagactcatagaaatttgtagacatgtatcatcaaaatatacaaggtca
aaggtaagaaaagccctaccaaaagattttgcctatataatagaagaacttcttcacgaa
tatccagaaagcttagacaagcacgggtattatggagaaatagttaaaacaattgtagct
atagatagagcaagagaatttattatggcactatcaaaccttatacaaagacttgtaata
gatagacttcatataattggtgacatttttgatagaggtccaggagctgaaataatcctt
gatacccttaaaaattatcactcagtagatattcaatggggtaatcatgatgttttatgg
atgggtgcttgtgcaggttcaaaagcatgtattgcaaatgttataagaatttctgctcgc
tattcaaatcttgatacaattgaggacggctacggtataaatctacttcctcttgcaacc
tttgcattagatttttataaagaagatccttgcacaggtttctttccaaagtttgatgca
gaaaaaaattacagcgtaacagaaatagaattaattgctaaaatgcataaggcaatagct
attattcaatttaagcttgaaggagaaataattaatcgtagacctggctttaatatggac
gacagacttctattaaataaaataaactttgaagcaggtactattgaacttgatgggaaa
acctataagttaaatgatacttattttccaaccattgatcctaaagatccttacaaactc
ctaaaagaagagcaagaactggtagaaaaattaagatcttcttttatgaatagtgataaa
ctaaacaaacatgtaagatttttattcgccaatggaagtatttatttaaaatacaactca
aaccttttatatcatggctgcataccaatgaacgagaatggaacatttaagaaagtaaga
ttaagagataaagaatacaacggaaaatctcttttagatagattggaaatacttgctcgc
gaaggttatttccacgaggacaatcctgctgctaaactatttggtacagatataatgtgg
tatctctggacaggtccttattctcctctattcggaaaagaaaagatgactaccttcgaa
agatacttcatagatgataaaaaaacgcatattgaaaagaaagacccttactacaacttt
agagataaagaagaagtttatgataacattttttccgaatttggcttagatcctaatgaa
tcacatattgtaaatggacatgtccctgttgaaaaaaagaaaggtgaaagcccaataaaa
gcaaaagggaaacttttagtaatagatggaggcttctctaaagcatatcaaggtaaaacc
ggtattgctggttatacattaatatataattcctttggacttcagcttgtatcacacgaa
ccttttcaatcaacagaaaaagctattaaagaagaaacggatatcctgtcatcaacagta
atactagaacattcaatggtcagaaaaaaggttgctgacactgatgtaggtgctatactg
caagaacagataaagaatcttaaaatgttactaatagcatacagaactggattaataaaa
gaaaagaatagtatttag

DBGET integrated database retrieval system