KEGG   Clostridium cellulovorans: Clocel_1499Help
Entry
Clocel_1499       CDS       T01294                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
ccb  Clostridium cellulovorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clocel_1499
Enzymes [BR:ccb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Clocel_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1844340..1846133
Genome map
AA seq 597 aa AA seqDB search
MAKSRLIGDYPVIGIRPTIDGRRGVLKVRESLEEQTMNMAKAAAELFTKNLKYSNGEPVK
VVIADTTIGRVAEAAACADKFRKEGVDVTLTVTPCWCYGAETMDMDPMTIKGVWGFNGTE
RPGAVYLASVLATHAQKGLPAFGIYGHDVQNADDTEIPEDVKEKLLRFGRAAVAAASMRG
KSYLQIGSICMGIGGSIIDPAFIEEYLGMRVESVDEVEIIRRMTEGVYDEAEFQRALAWT
KEKCIEGFDKNPADVQKTREEKDADWEFVVKMMCIIKDLMNGNPNLPAGCEEEMVGHNAI
AAGFQGQRQWTDFYPNCDFPEALLNTSFDWDGAREPYILATENDVLNGIGMLFGKLLTNT
AQIFADVRTYWSPEAVKKATGYELEGVAKESDGFIHLINSGAACLDACGEAKDENGNGIM
KPWYDITDKDQDAILKATTWNAADNGYFRGGGYSSRFLTNAEMPVTMMRLNLVKGLGPVL
QLVEGHTVNLPEEVSDKLWKRTDYTWPCTWFAPRLTGTGAFKSAYDVMNNWGANHGAICY
GHIGADIITLCSILRIPVSMHNVPEEKVFRPAAWNAFGMDKEGQDYRACAAYGPMYK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtagattaattggagactatcctgtaatcggtatcagaccaactattgat
ggtagaagaggtgtattaaaggttagagaatctctagaagaacaaacaatgaatatggca
aaggcggcagcagagctttttactaaaaacttaaaatattcaaacggagaaccagttaaa
gttgttattgcagatactactattggacgtgtagcagaagcagcagcttgtgcagataaa
tttagaaaagagggtgtagatgttactcttacagtaactccttgttggtgctatggtgca
gaaacaatggatatggaccctatgactatcaaaggagtatggggctttaatggtacagaa
agaccaggtgcagtttacttagcatcagttttagctactcatgctcaaaagggacttcct
gccttcggtatatatggacatgatgttcaaaatgctgatgacacagaaattccagaagac
gtaaaggaaaaattattaagattcggtagagcagcagttgcagcagcttctatgagaggt
aaatcttacttgcaaatcggatcaatttgtatgggtattggcggttcaattatcgatcca
gcattcatcgaagaatatcttggcatgagagtagaatctgttgatgaagtagaaatcatc
agaagaatgacagaaggagtttatgatgaagctgaattccaaagagctttagcatggaca
aaagaaaaatgtatagaaggctttgataaaaacccagcagatgttcaaaagacaagagaa
gaaaaagatgcagattgggaattcgttgttaagatgatgtgcattatcaaagatttaatg
aacggaaatccaaatcttccagctggttgtgaagaagaaatggttggacacaatgctata
gcagcaggtttccaagggcaaagacaatggacagacttctatccaaattgtgacttccca
gaagctttattaaatacttcctttgattgggatggtgcaagagaaccatatattcttgca
actgaaaatgacgtattaaacggtatcggaatgttgtttggaaaattattgactaatacg
gctcaaatctttgctgacgttcgtacttattggagtccagaagcagtaaagaaagcaaca
ggctatgaacttgaaggtgttgcaaaggaatcagatgggttcattcatttaatcaattca
ggggctgcttgtcttgatgcttgtggagaagctaaggacgaaaacggaaacggaataatg
aaaccttggtatgacattacagataaagatcaagatgctatcttaaaggcaactacttgg
aatgcagctgataatggttactttagaggcggtggatattcttcaagattcttaacaaac
gcagaaatgcctgtaacaatgatgagattaaacctagttaaaggtttaggaccagtgctt
caattagtagaaggacacactgtaaatcttccagaagaagtttcagataaactttggaag
agaactgattatacatggccatgtacatggtttgcgccaagattaacaggaactggagca
tttaaatcagcttatgatgttatgaataactggggagcaaatcacggagcaatctgttat
ggacacattggagcagatattataactttatgttctatcttaagaataccagtatcaatg
cataatgtaccagaagaaaaagtatttagaccagcagcttggaatgcttttggaatggat
aaagaaggacaagattacagagcttgtgcagcatacggtccaatgtataaatag

DBGET integrated database retrieval system