KEGG   Clostridium cellulovorans: Clocel_1502Help
Entry
Clocel_1502       CDS       T01294                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ccb  Clostridium cellulovorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Clocel_1502
Enzymes [BR:ccb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Clocel_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1848595..1849281
Genome map
AA seq 228 aa AA seqDB search
MNYMEIREQICDICHKMWQLGWVAANDGNVSVKLEDGTFLATPTGISKCFITPEKLVHIN
ADGEVLDGPEGAKPSSEIKMHLRCYKEREDVGAVVHAHPPTATGYAVAHVDLDRYTMIET
VIAIGSIPVTPYGTPSTYEVPDSIAPYLQEHDVLLLANHGALTVGSDLITAYYRMETLEL
YAKISLTAHLLGGEKEISKENIDTLVGMRPKYGVTGKHPGFKRYRKEK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatggagataagagaacaaatctgtgacatatgccataagatgtggcaatta
ggctgggtagcagctaacgatggtaatgtatctgtaaaacttgaggatggtacattttta
gcaacaccaacaggaataagtaaatgctttataacaccagaaaagttagttcatataaat
gctgatggagaagttcttgatgggccagaaggagcaaaaccttcttcagaaataaaaatg
catttaagatgttacaaagaaagagaagatgtaggagcagttgtacacgctcatccacca
acagcaactggatatgcagtagctcacgtggacttagatcgttacactatgattgaaact
gtaatagcaattggttctattccagtaacaccatatggaacaccatcaacttatgaagtt
ccagattcaatagcgccatatttgcaagagcatgacgtattgctattagctaaccatgga
gctttaaccgttggttctgacttaatcactgcatattacagaatggaaactctagaattg
tatgcaaagataagcttaactgctcatctactaggtggggaaaaagaaatttcaaaggaa
aacatagatactctagttggtatgagacctaagtatggagtaactggaaaacacccagga
tttaaacgttacagaaaagaaaaataa

DBGET integrated database retrieval system