KEGG   Clostridium cellulovorans: Clocel_1517Help
Entry
Clocel_1517       CDS       T01294                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ccb  Clostridium cellulovorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Clocel_1517
Enzymes [BR:ccb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Clocel_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1867817..1868713
Genome map
AA seq 298 aa AA seqDB search
MKIINFGSLNIDKVYNVNNFVKAGETIASNSMKLFPGGKGLNQTIAIARAGGEVYHAGAI
GYDGALLEECLKVDKVKVDYLQRLEEPSGHAIIQVTDKGENAIIVDSGANGKIDNEYVDK
VLMNFNKEDLLLIQNEISNVGYIIKKADELGLTIVFNPSPITKAMVSYPLDLVDIFILNE
VEGEALTKKQKPVEIVERLVQLYPKAKIILTLGEKGSVYKGGDEHNQFGIYKNKVVDTTA
AGDTFCGYFITCLSKNIETALAMKYASAASSISISREGATTSIPYMSEVQEFIDNCGN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataataaattttggttcgttaaatatagataaggtgtacaatgtaaataatttt
gtaaaggctggtgaaactatagcctcaaattctatgaagctgtttccaggaggcaagggt
ttaaatcaaactattgctattgctagagctggaggcgaggtttatcatgcaggagctata
ggatatgatggagctttactggaggagtgtttaaaagttgacaaggtaaaggttgattat
cttcaaagactggaggagccaagtggtcacgctattattcaagttactgacaaaggggaa
aatgcaataatcgttgatagtggtgctaatggaaagatagacaatgaatatgtggataaa
gtattgatgaattttaataaggaagatcttttactaatacaaaatgaaataagcaatgta
ggatatattattaaaaaagcagatgaattaggtttaaccatagtatttaatccctcacca
attacaaaggctatggtttcttatccactggatttagtggatatttttatattaaatgaa
gtggagggtgaagctttaacgaagaagcaaaagcctgtagagatagttgaaaggttagtt
caattgtatccaaaggcaaaaattattttaactttaggggagaagggctctgtatataaa
gggggagatgagcacaaccagttcggaatttataaaaataaagtagtggatactacagca
gcaggagataccttctgtggttatttcataacctgtttgtcaaaaaatatagagactgct
ttggccatgaagtatgccagtgctgctagttcaattagtatatcaagagaaggtgcaacc
acatccattccatatatgtctgaagtacaagagtttatcgataattgtggaaattaa

DBGET integrated database retrieval system