KEGG   Clostridium cellulovorans: Clocel_1553Help
Entry
Clocel_1553       CDS       T01294                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ccb  Clostridium cellulovorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Clocel_1553
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Clocel_1553
Enzymes [BR:ccb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Clocel_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1916352..1917317
Genome map
AA seq 321 aa AA seqDB search
MKELRHFLEPRDLKLQEYEELFELVDKIMANPKDYSEIARGKILAALFFEPSTRTRLSFE
SAMLKLGGSVIGFSEASSSSTAKGESIEDTTRMASIYGDIIAMRHPEAYSPCKASKVSTI
PVINAGDGGHQHPTQTLADLITIRAKFNRLNNLKIGFCGDLKFGRTVHSLAQAFSEYENN
SFVFISPKELKMPDYVKQELEQKDMPYIETDNLEDAIADLDIIYMTRVQKERFEDADEYE
RLKDFYILDGEKMSKAKDECIVLHPLPRVNEISCEVDSDPRAWYFKQAEYGMYGRMALII
KLLQLDCDKVLRLKYYELEGV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattaagacatttccttgaaccaagggatttaaagttacaggaatacgaagaa
ttatttgaattagtagataaaatcatggcaaatccaaaagactattctgaaattgctagg
ggcaaaatcttagcagctctgtttttcgaaccaagtacaagaactagattaagctttgaa
agcgcaatgctaaagcttggtggtagcgtaattggtttttcagaagcatcctcttcttct
accgcaaagggtgaaagcattgaagatacaactaggatggcaagcatatatggtgatatt
attgctatgcgtcatccagaagcttactcaccttgcaaagcatcaaaggtttcaacaatc
ccagtgattaatgctggagatggaggacatcaacatcccacacaaacattagcagattta
ataactataagagcaaaatttaatagattaaataacttaaaaataggtttctgtggagat
ttaaagtttggaagaactgtacattctcttgcacaagcttttagtgagtatgaaaacaat
agctttgtattcatatcaccaaaggaacttaagatgccagattatgtgaagcaagaactt
gagcagaaagatatgccttatattgagacagataacttagaagatgcaatagcagactta
gatataatatatatgacaagagttcaaaaagaaagatttgaagacgctgatgaatatgaa
agattaaaagatttttatattctagacggagagaaaatgtcaaaggctaaggatgagtgt
attgtgttacacccactgccaagagttaatgaaatatcttgtgaagttgatagtgatcca
agggcttggtactttaagcaagcagaatacgggatgtatggaagaatggctctaataatt
aagcttctacagctagattgtgacaaggtattaaggttaaagtattatgagctggaggga
gtgtaa

DBGET integrated database retrieval system