KEGG   Clostridium cellulovorans: Clocel_1668Help
Entry
Clocel_1668       CDS       T01294                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ccb  Clostridium cellulovorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ccb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ccb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2048171..2049073)
Genome map
AA seq 300 aa AA seqDB search
MDINIIGVPLFYGCDRKGVELAPDIIRHKGVSEIISKYNHTVYDLGNIYVPQVDAESKYI
SHKSMKYLNEVIETNRNLAQAVYSSLCANSLPFVIGGDHSLGLGTISGASKFYRNLAVIW
IDAHGDVNTEETSPTGNIHGMPLAASMNIGHSSLTDLFYKGQKVNPNNVFILAARDLDEG
EVELIKERKLNVYTMKDIRTRGLESIVKEIMDKISENNADGVHLSFDIDSIDPEHIPGTG
TPVEDGLSIDEAKYILKTFVQSEKISSIDMVEFNSDLDHEDARTSKAVLDLIDHTFKNLH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttggatattaacattattggcgtacctttgttttatggatgcgatagaaaaggtgtagaa
cttgctccagacatcattaggcataaaggagtttctgagattatatcaaagtacaatcat
acggtttatgatctaggaaatatttatgtaccacaagttgatgctgagtcaaaatatatt
tctcacaaaagtatgaagtatcttaatgaagtaatagaaacaaacagaaatctagcacaa
gctgtgtattcttcgctttgtgctaacagtcttccttttgttataggcggagaccattca
ttaggccttggtactataagtggcgcaagtaaattttatagaaatcttgcagttatatgg
atcgatgctcatggagatgtaaacacagaagaaacttctcctactggtaatatccatgga
atgcctttagctgcttctatgaatattggacattcttctttaacagatcttttttataaa
ggtcaaaaagttaatccaaacaacgtctttattttagcagctagagatcttgatgaaggc
gaagtagaattgattaaagaaagaaaacttaatgtatacactatgaaagatattagaact
cgtggactagagtctattgttaaagaaattatggacaagatatctgaaaataatgctgat
ggagttcacctaagttttgatattgactctattgatcctgaacatattccgggaacagga
acccctgtagaagatggtctttctattgatgaagccaaatatatactaaaaacctttgtg
caatctgaaaaaatatcatctattgatatggtagaatttaattctgacctagatcatgaa
gacgctagaacgtctaaagctgtactggatctgattgatcataccttcaaaaacttacat
tag

DBGET integrated database retrieval system