KEGG   Clostridium cellulovorans: Clocel_1780Help
Entry
Clocel_1780       CDS       T01294                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ccb  Clostridium cellulovorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ccb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2152681..2153835
Genome map
AA seq 384 aa AA seqDB search
MRNITILGATGSIGTQALEIIRGDRGNFNLLAASANTNVTSIKNIIDEFAPKYITMMDKD
SYNIVKDYCKAKNLSVEVLYGVEGLIEISTLSDVDLVLTSLVGMIGLRPTIEAIKAGIDI
ALANKETLVVGGEIVMDLAKKHKVKILPVDSEHGAIFQCLQGNQYKDIDKILLTASGGPF
RGRPLNELQKVDVNDALSHPKWNMGKKISIDSATLINKGLEVIEAKWLFDIQPSNIEVLV
HPQSIVHSMVQYKDGSVIAQLSNPDMKLPIQYALNYPIRKASVIKTLNLLEIRELTFEKP
DLNTFKGLKLAYDAINEGGNLPTILNSANEVAVELFLNGKISFLDIANIIEQCMLKIEKI
RNITLDEILYTEELVRRYIKDLIK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatattaccatactaggagctactggatccataggaacgcaagctctagaaata
attagaggagatagaggaaattttaatcttcttgctgcgtctgcaaatactaatgtaact
tccattaagaatattatagatgaatttgctccaaagtacataacgatgatggataaagat
tcctataacattgtaaaagattattgtaaagctaaaaatttgtctgtagaggttttatat
ggtgtcgaaggcttaattgaaataagtacattaagtgatgttgacttggtgctaacttca
cttgtaggaatgataggtttaagacctactattgaggcaataaaagctggtattgatata
gcacttgctaataaagaaactttagtagtaggtggagagattgtcatggaccttgctaaa
aagcataaggtcaagatattaccagtggattcagaacatggagcaatatttcaatgtctt
caaggaaatcaatataaggacatagataaaattcttttaaccgcatcaggtggaccattt
aggggtaggcctttaaatgagctccaaaaggtagatgttaatgatgctttgagtcatcca
aaatggaatatggggaaaaagatatcaattgattcggctacattaataaataagggtcta
gaggttattgaagcaaaatggctttttgatattcagccttctaatatagaagttttagtt
catcctcaaagtatagttcattcaatggttcagtacaaagatggtagtgttatagctcag
ttatcaaaccctgatatgaagctacctatccaatacgcacttaattatccaattcgaaaa
gctagtgtaattaagactcttaacttattggaaataagggagctaacctttgaaaaacca
gacttaaatacttttaaaggtttaaaacttgcatatgatgctataaatgaaggaggaaat
cttccaacgatcttaaatagtgccaatgaagtggcagtagaattgtttttgaatggtaaa
ataagtttcttagatatagctaatatcatagaacaatgtatgttaaaaattgaaaaaata
aggaatattactttggatgaaatattatatacagaagaattagtaagaagatatataaaa
gatttaataaagtag

DBGET integrated database retrieval system