KEGG   Clostridium cellulovorans: Clocel_1869Help
Entry
Clocel_1869       CDS       T01294                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ccb  Clostridium cellulovorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Clocel_1869
Enzymes [BR:ccb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Clocel_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2254383..2255018
Genome map
AA seq 211 aa AA seqDB search
MVNETKGLLVVISGPSGAGKGTICKKLMEKNNFWLSVSATTRSPRAGEENAKSYYFLTRD
EFEEKIKCNDFLEYAEVYGNLYGTPRSSVMEMIDNGKNVILEIDIQGALKVKEAFPEGVF
IFILPPSMEELKNRIIGRGSETPESLMTRFKSAYKEINYVSKYNYAVVNDEVALAVEKIQ
GILVAEKCRVDRIKEDILDNKEGIVHEQFYD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgaaacaaagggtttattagttgtaatttctggaccatcaggtgctggaaag
ggcaccatatgcaagaagcttatggaaaaaaataacttttggctttctgtttctgctact
actagaagtccaagagctggggaagaaaacgcaaagagttactattttttaacaagggac
gaatttgaagaaaagataaaatgtaatgattttcttgaatatgctgaagtatatggtaat
ttatacggaactcctcgttcaagtgttatggaaatgattgataatggcaaaaatgttata
ttagaaattgatattcaaggagcgcttaaggttaaagaagcatttcctgagggagtattt
atatttattcttcctccatctatggaagaacttaagaatagaataataggcagaggtagt
gaaacacctgaatcgctaatgacaagatttaaatcagcctacaaggaaataaactatgtt
tctaaatataactatgctgtagtaaatgatgaagttgctcttgctgttgaaaaaattcaa
gggattttagtagcagaaaagtgcagagttgatagaataaaagaagatatattagataat
aaggagggaattgttcatgagcaattctatgattaa

DBGET integrated database retrieval system