KEGG   Clostridium cellulovorans: Clocel_2118Help
Entry
Clocel_2118       CDS       T01294                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccb  Clostridium cellulovorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clocel_2118
   00052 Galactose metabolism
    Clocel_2118
   00500 Starch and sucrose metabolism
    Clocel_2118
   00520 Amino sugar and nucleotide sugar metabolism
    Clocel_2118
Enzymes [BR:ccb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clocel_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2524262..2525155)
Genome map
AA seq 297 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNK
RAIEDHFDKSVELEKQLENTGKNELLQLVDSISNMANIYYIRQKEPRGLGHAIACAKTFV
GNEPFAVMLGDDVVDNKEPCLKQLVNCFNEYKTTVLGVQRVDEKDVSKYGIVNGKPIEDG
VFKVKDLVEKPSPDEAPSNIAILGRYIITPRIFDILENTSPGKGGEIQLTDALRTLMMEE
AMYAFEFKGRRYDVGDKLGFLQATVEFALKREDLGGEFLQYLINLKNNSEFMEKLHD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaagctattatacctgctgctggacttggaacaagatttttaccagca
acaaaagctcagccaaaagaaatgcttccaatagttgataagccaacaattcagtatatt
attgaagaagcagtagcatctggtatagaagaaattttaattattactggaagaaataaa
agagcaattgaagatcattttgataaatcagttgaacttgaaaagcaacttgagaacact
ggaaaaaatgaacttttgcaacttgtagatagcatatcaaatatggctaatatttattat
ataagacagaaagagccaagagggcttggccatgcaattgcttgtgcaaaaacctttgtt
ggtaacgaaccatttgccgtaatgctaggtgatgatgttgtggacaataaagaaccttgc
ttaaaacaattagtaaactgctttaacgaatataagacaactgtattaggtgtacaaaga
gtagatgaaaaggatgtcagcaaatatggaattgtaaatggtaaacctatagaagatggc
gtatttaaagttaaagatttagtagaaaaaccatctcctgatgaagcgccatctaatatt
gcaattcttggtagatacataataacgcctagaatctttgatattttagagaatacatct
cctggaaagggtggcgaaattcaattaacggacgcattaagaaccttaatgatggaagaa
gcaatgtatgcctttgaatttaaaggacgtagatatgatgttggagacaaactaggtttt
cttcaagcaacagtggaatttgcacttaaacgtgaggatttaggaggcgaatttttgcaa
tatttaattaacttaaaaaacaatagtgagtttatggagaaactacatgattaa

DBGET integrated database retrieval system