KEGG   Clostridium cellulovorans: Clocel_2160Help
Entry
Clocel_2160       CDS       T01294                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clocel_2160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocel_2160
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocel_2160
Enzymes [BR:ccb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocel_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2574241..2575443)
Genome map
AA seq 400 aa AA seqDB search
MSYNLPDERGHFDIFGGKFLGETFVEPLRQLEQCYNEAMEDPSFIAELDKYLKDYSGRET
PLYYCERLTEYCGGPKIYLKREDLNHTGSHKINNCLGQALLAMRMGKKRIVAETGAGQHG
VATATVAAMFNLECKVFMGAEDVKRQALNVFRMRLLGTEVIPVHSGNKTLKDACNEAFRY
WASNVEDTNYILGSVLGPHPYPKMVRDFQSVIGKETKKQILEAEGRLPDAIVACVGGGSN
AMGMFYPFIEDTDVELIGAEAGGMGIDTEEHAATISKGEKGILHGALMYLIQDENGQVIE
PYSISAGLDYPGVGPEHCYLFDAKRAQYYPINDDEALEAFQLLSKIEGIIPALESAHAVA
YAVKKAKTMKKDEILVVCLSGRGDKDVERVSEILGGQNNE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagttataatttaccagacgaaagaggacattttgatatatttggtgggaagtttctt
ggtgaaacctttgttgaaccattaagacaacttgaacaatgctataatgaagcaatggaa
gatccaagctttattgctgaattagacaaatatttaaaagattattctggccgtgagaca
ccattatactattgtgaaagattaacagaatattgtggtggaccaaagatttatttaaag
agagaagatttaaatcatactggttctcacaaaataaacaattgtttaggtcaagcactt
ttagcaatgagaatgggtaaaaagagaattgttgctgaaactggtgcagggcaacacggt
gttgcaactgcaactgtagctgctatgtttaatttagagtgtaaagtattcatgggagct
gaagatgtaaaaagacaagcattaaatgtatttagaatgagacttcttggaacagaagta
attccagttcatagtggaaataaaacacttaaagatgcttgtaatgaagcttttagatat
tgggcatcaaatgttgaggatactaactatatcttaggttctgttttaggaccacaccca
tatccaaagatggttagagatttccaaagtgtgattggaaaagaaacaaagaaacaaatt
ttagaagcagaaggaagacttccagatgccatagtagcttgcgttggtggtggaagtaat
gcaatgggaatgttctatcctttcattgaagatacagatgttgaacttataggtgctgaa
gctggtggtatgggcattgatacagaagagcatgctgcaactatttctaaaggtgaaaaa
ggaatactacatggtgcattaatgtatcttatccaagatgagaatggtcaagttattgaa
ccttattcaatttctgctggccttgattatccaggagttggccctgaacattgctatctt
tttgatgctaaaagagctcaatattatccaataaacgatgatgaagctttagaagctttc
caacttctttcaaaaatcgaaggaataattccagctttagaatcggctcatgctgtagct
tatgcagtaaaaaaagcaaagacaatgaagaaagatgaaattttagttgtttgtctttct
ggaagaggcgataaggatgttgaaagagttagtgaaatcttaggaggtcaaaataatgag
taa

DBGET integrated database retrieval system