KEGG   Clostridium cellulovorans: Clocel_2205Help
Entry
Clocel_2205       CDS       T01294                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ccb  Clostridium cellulovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ccb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2620163..2621125)
Genome map
AA seq 320 aa AA seqDB search
MNRTRRLRSSDNIRALVRETEVNINDLVYPFFVIEGDNIKNPINSMPGIYQYSLDRIGEL
LDEIVESGVKTVLLFGIPLHKDEVGSEAYNPDGIVQKAIRIIKEKHKDLVVIADVCLCEY
TSHGHCGLIKEEAIVNDDTLPLLAKMAVTCAEAGADIIAPSDMMDGRVAVIREALDNNGF
KDRIIMSYSAKYSSGYYSPFREAAESAPKFGDRKTYQMDSANKTEAIREVLYDIEEGADI
VMVKPALAYLDIIKVVSDEVNVPVAAYNVSGEYSMVKAAAMNGWIDERKIVMENLLAIKR
AGAKIIITYHALDAAKWIKE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaacaagaagattacgatctagtgataatataagagctttagtaagagaaaca
gaagttaatattaatgatcttgtttatcctttttttgtaattgaaggagacaacataaaa
aatccaatcaattccatgccaggaatttatcaatattccttggatagaatcggtgaactt
ttagatgaaatagtagaatctggggtgaaaacagttttattatttggaataccattacat
aaagatgaggttggtagtgaagcatataatccagatggaatagttcaaaaggctataaga
ataattaaagagaagcataaggaccttgtagttattgctgatgtatgcttatgtgaatac
acttctcatggccattgtggacttataaaagaagaggctattgtaaatgacgatacttta
cctttattagctaaaatggcagttacttgtgctgaagctggagctgatattatcgcacca
tcggatatgatggatggtagagttgcggtaattagagaagctttagataacaacggcttt
aaagatagaatcattatgtcatatagtgcaaagtattcttcaggatattattcacctttt
agagaggctgctgaatcagcaccgaaatttggtgatagaaaaacttatcaaatggacagt
gctaacaaaactgaagcaataagagaagttctttatgatattgaggaaggtgctgacatt
gttatggttaaaccagcactagcatatcttgatataattaaagtcgtaagtgatgaagta
aacgttcctgtagctgcctataatgttagtggagagtattcaatggtaaaagccgcagct
atgaatggatggatagatgaaagaaaaatcgttatggaaaatctccttgctataaaaaga
gcaggagcaaaaataataattacatatcatgcacttgatgcagcaaagtggataaaggaa
tag

DBGET integrated database retrieval system