KEGG   Clostridium cellulovorans: Clocel_2402Help
Entry
Clocel_2402       CDS       T01294                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00010  Glycolysis / Gluconeogenesis
ccb00071  Fatty acid degradation
ccb00350  Tyrosine metabolism
ccb00620  Pyruvate metabolism
ccb00625  Chloroalkane and chloroalkene degradation
ccb00626  Naphthalene degradation
ccb00650  Butanoate metabolism
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
ccb01120  Microbial metabolism in diverse environments
ccb01130  Biosynthesis of antibiotics
ccb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_2402
   00620 Pyruvate metabolism
    Clocel_2402
   00650 Butanoate metabolism
    Clocel_2402
  Lipid metabolism
   00071 Fatty acid degradation
    Clocel_2402
  Amino acid metabolism
   00350 Tyrosine metabolism
    Clocel_2402
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clocel_2402
   00626 Naphthalene degradation
    Clocel_2402
Enzymes [BR:ccb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Clocel_2402
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clocel_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADL52118
JGI: Clocel_2402
UniProt: D9SPY2
Position
complement(2844661..2847270)
Genome map
AA seq 869 aa AA seqDB search
MKVTNVEQLKKRIAQIREAQRKFAEFSQEQVDKIFREAAMAALNERISLAKLAVEETRMG
VFEDKVIKNHLASEYVYNKYKNEKTCGVLETDDAFGITKVAEPIGVVAAIVPTTNPTSTA
IFKSLIALKTRNGIIFSPHPRAKKSTIAAAKIVLDAAVKAGAPEGIIGWIDEPSIELSQI
VMQEADITLATGGSALVKAAYSSGKPALGVGAGNTPVIIDETAHIKMAVNSILLSKTFDN
GVICASEQAIVVIDKIYDEVKNEFIERGAYFLKDDELDKVRKTIMINGAVNPDIVGQTAY
KIAQLAGIEVSEATKVLIGEVELIGPEEPLSHEKLSPVLAMYKVRSFDEALQKTTKLLAY
GGMGHTSVLYTDELLCKDRIESFGAAMKTSRTFINMPASHGAAGDTYNFKVPPSFTLGCG
SWGGNSVSENVGVKHLLNVKSVARRRENMLWFKVPEKIYFKYGCLGMALEELKDMEKKKA
FIVTDKVLYDLGVLDNVTKVLDKIGVDYRIFYDVQPDPTLESARKGAKEMINFEPDTIIA
VGGGSPMDAAKIMWVLYEQPDVAFEDLAMIFMDIRKRIYNMPKIGKKATFVAVPTSAGTG
SEVTPFAVITDEKTGVKYPLADYQLTPGMAIIDAELMMNMPKGLTAASGIDALTHAIEAY
VSVLASDYTNGLALEAARLIFKYLPLAYTEGRTNIKAREKMAHASTIAGMAFANAFLGVC
HSMAHKLGAEHHVPHGTANALLINEVIRFNSVEDPRKQAAFPQYKYPNAKSRYAKMADYL
QLGGGTEDEKIEALINAIDQLKLKLNLPMTIKEAGVSEKKFYASLDKMSELSFDDLCTGA
NPRYPLISEIKKMFINVFDNTQETVIREE
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttactaacgttgaacagttaaaaaaaaggattgcgcaaataagagaggctcaa
aggaaatttgccgagttttcacaagaacaagttgataaaatctttagagaagcagctatg
gctgctctaaatgaaagaatatccttagcaaagctggcagttgaagaaactcgcatggga
gtatttgaggacaaagttattaaaaatcatttagcatcagaatatgtttacaataagtat
aaaaatgaaaaaacttgtggagttttagaaacagatgatgcttttggtattacaaaggta
gctgaaccaattggagttgttgctgcaatagttccaactacaaacccaacttcaacagcg
atatttaaatctttgattgcattaaaaactagaaacggtataattttttctccacatcct
agggcaaagaaatcaactatagcggcagctaaaatagttcttgatgcagcggttaaagct
ggagcaccagaaggaataataggatggatcgatgaaccatcaattgaactttcacaaatt
gtaatgcaagaagcagatattactttagcaacagggggatcagccttagttaaggctgca
tactcatctggcaaaccggcacttggagttggtgcaggtaacacgccagtaataattgat
gaaacggctcatattaaaatggcagttaactcaatacttctttcaaaaacttttgataat
ggcgtcatttgtgcatcagagcaggccattgttgtaatagataaaatttatgatgaggtt
aaaaatgagtttatagaaagaggggcatattttttaaaggatgatgaattagataaagtt
agaaaaactataatgattaatggtgctgttaatccagatattgttggtcaaactgcttat
aaaatagctcaattagcaggaattgaggtttcagaagcaactaaggtcttaattggagaa
gttgaattaatagggccagaagaaccattgtcacatgaaaagttatctccagttttagct
atgtataaggtaagaagctttgatgaagctcttcagaagactaccaagcttttagcttat
ggtggaatgggacacacttctgttttatacactgatgaattactatgtaaggatagaatt
gaaagttttggcgcagcgatgaaaacctcaagaacttttataaatatgccagcttcacat
ggtgctgcaggtgatacttataactttaaagttcctccatcatttacgctaggttgtggt
tcttggggcggaaactcagtatcagaaaatgttggagttaaacacttgttaaatgttaag
agtgtagctagaaggagagaaaatatgctttggtttaaggtgccagaaaagatttacttt
aagtatggttgtttggggatggctcttgaagaactaaaagatatggaaaagaagaaggca
tttattgtaacagataaggttttatatgacttaggcgttctcgataatgtaacaaaagta
ttagacaaaataggtgttgattatagaatattctacgatgtacagccagatccaacactt
gaaagtgcgagaaaaggtgcgaaagaaatgattaactttgaacctgatacaataatagca
gttggtggagggtcaccaatggatgcagctaaaattatgtgggttctttacgaacaacct
gatgtagcctttgaagatttagcaatgatttttatggacattagaaagaggatatacaat
atgcctaagattggtaagaaagctacttttgtcgctgtaccaacttcagcaggtacaggt
tcagaagttacaccgttcgcagttatcacagatgaaaagactggagtgaagtatccatta
gcagattatcaattaactccaggtatggctataattgatgctgaattaatgatgaatatg
ccaaaaggtctaactgctgcatcaggtatagatgcgttaacacatgcaattgaagcttat
gtatcagttcttgcatccgactatactaatggcttagctttagaagcagcaagattaatt
tttaaatatttaccgttagcatacactgaaggaagaaccaatataaaagctagagaaaaa
atggctcatgcttcaacaatagcaggtatggcatttgctaacgcatttcttggagtatgc
cactctatggcacataaattaggagcagaacaccatgtgccacatggaactgcaaatgca
ttactaataaatgaagtaatcaggtttaattcagtagaagatccaagaaagcaagctgct
ttcccacagtacaagtatccaaatgctaaatcaagatatgcaaaaatggctgactaccta
caattaggtggaggaacggaagatgaaaagattgaagcattaataaacgccattgatcaa
ttaaagttaaaattaaatcttccaatgaccattaaagaagctggagtttcagagaagaag
ttctatgcatctttagataaaatgtcagaattatcttttgatgatttatgtacaggagca
aatccaagatatccattgataagtgaaataaagaaaatgtttattaatgtttttgataat
acacaagagacagtgataagagaagagtaa

DBGET integrated database retrieval system