KEGG   Clostridium cellulovorans: Clocel_2504Help
Entry
Clocel_2504       CDS       T01294                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clocel_2504
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocel_2504
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocel_2504
Enzymes [BR:ccb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocel_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3026918..3028297
Genome map
AA seq 459 aa AA seqDB search
MKKVPHRLYLTEDQMPKQWYNLRADMKEQPEPMLNPANFEPAKEEDLYPVFCKELARQEM
DSTTRYFDIPEPILDMYKIYRPSPLIRAYNLEKALGTPAKIYYKFEGNNTSGSHKLNSAI
AQAYYAKEQGLTSLTTETGAGQWGTALSEACSYYDIPLTVYMVKVSYNQKPYRKAIIQTF
GADVIPSPSDTTNAGRAILESDPNTGGSLGCAISEAVEKAVTTEGCRYVLGSVLNQVLLH
QSIIGLEAKAAMDILGEYPDVVIGCAGGGSNLGGLIAPYMQDKLLGKANPRILAVEPASC
PSLTRGRYAYDFCDTGKVTPLAKMYTLGSGFVPSGNHAGGLRYHGMSPVLSKLYHDGYMD
AISVEQTKVFEAAVFFAKNETILPAPESAHAIRAAIDEAIKCKETGEAKTILFGLTGTGY
FDMTAYTSYHEGKMTDYIPSDEELKIGFNGLPKIPGIQE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaccacatagattatacttgactgaagatcaaatgccaaaacaatggtat
aaccttagagcagatatgaaagaacaaccagaaccaatgctaaaccctgctaactttgaa
cctgctaaagaggaagatttatatcctgtattttgtaaagaacttgcaagacaagaaatg
gattctacaacaagatattttgatataccagaaccaattctagatatgtacaagatttac
agaccatcaccacttattcgtgcatacaatttagaaaaagctcttggaacaccagcaaaa
atttactataagtttgaaggaaataatacctcaggtagccataaacttaattctgctatt
gctcaagcatattatgctaaagaacaaggacttacaagtctaacaactgaaactggagct
ggtcagtggggaactgctctatcagaagcttgttcttattatgatatacctttaactgta
tatatggtaaaagtttcatataatcaaaaaccttatcgtaaagcaattattcaaaccttt
ggagcggatgtaattccaagtccaagtgacactactaatgcgggacgtgctattttagaa
tcagaccctaatactggtggtagccttggttgtgctatttcagaggcagtagagaaagct
gtcactacagaaggttgtagatatgttttaggttcagtactaaatcaagttttacttcat
caatcaattatcggtttagaagccaaagctgctatggatatattaggtgaatatccagac
gttgtaataggctgtgctggtggtggttctaatttaggaggacttatcgcaccttacatg
caagataaattacttggaaaagcaaaccctagaattcttgcggttgaacctgcatcttgt
ccttcattaactcgtggaagatacgcttacgacttctgcgatacaggaaaggtaacacca
cttgcaaaaatgtatacattaggtagtggatttgttccttctggtaatcacgctggtgga
cttagatatcatggaatgtctccagttctttcaaagctttatcatgatggctacatggat
gcaatatcagttgaacaaacaaaggtatttgaagcagctgtattctttgctaagaatgaa
acaattcttccagcaccagaatccgctcatgcaatccgtgctgctatagatgaagctata
aaatgcaaagaaactggcgaagcaaaaactattttatttggtcttacaggtactggttac
ttcgatatgactgcttacacatcatatcacgaaggaaaaatgaccgattatataccttca
gacgaagaattaaaaattggttttaatggccttccaaaaattcctggaattcaagaataa

DBGET integrated database retrieval system