KEGG   Clostridium cellulovorans: Clocel_2509Help
Entry
Clocel_2509       CDS       T01294                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ccb  Clostridium cellulovorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Clocel_2509
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Clocel_2509
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Clocel_2509
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Clocel_2509
Exosome [BR:ccb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clocel_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3032995..3034512
Genome map
AA seq 505 aa AA seqDB search
MKRKILAILLSVTAAVTMLTGCGTSSKKEVKNTEVTASKSTEGKTPKYVFLFIGDGMSSV
QINATQVYRGNNTSGQIATKPLNFTGFPAVGLATTFDATSFCPDSASTGTSISSGVKTHS
GVIGLNVDKTTKPESITEKLKAAGKKIGIVSTVTINHATPAAFYAHVPSRNDYYDIAMQL
PESNFDYFGGGSIYKATGDKKDKQDAYEVIKSKGYTIANKKEDIQKLDSSSNKVYAVTPV
TEDSGSMPYTIDTKDGDLTLADYVSKGIDILDNDKGFFLMCESGKIDWACHANDAMSAIK
EVIGLESAVQKAIDFAGKHPDETLILVTGDHETGGMTIGYAATGYNTAFNILDKQKISYI
AFDTLISKKKEANPNISFEEVMPMIKENFGLIAPGDADANVEANKPYVLTSYEYQKLQNA
FAESMKKADQRTKNEETAVLYGEYDPLSVTITHIINNKAGIGWTSYSHTGTPVPVYAYGA
SSEIFEGSYDNTDIFKKLVDVCKVK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagattttagcaatactattatctgtaacagctgcagtaacaatgttaact
ggttgtggaacttcttcgaaaaaggaagtaaaaaacactgaggttacagcttctaaatcc
acagaaggaaaaactccaaaatatgttttcctttttattggtgatggtatgtctagtgtg
caaattaacgctactcaggtatacagaggaaataacacctcaggacaaatagctactaaa
cctcttaattttacaggctttcctgccgtaggacttgcaactacctttgatgcaacttcc
ttctgccctgactctgcatctacaggcacttctatttctagtggtgttaaaacccatagt
ggagttatcggtttaaatgtagataaaactactaaacctgaaagtataacagaaaaatta
aaagctgctggtaaaaagattggtattgtttcaacagttacaataaaccacgctactcca
gctgccttctatgcccatgttccatcaagaaatgattattatgacatagcaatgcaactg
ccagaaagtaactttgattattttggtggtggaagcatctataaagcaacaggtgataaa
aaagataaacaggatgcttacgaagttataaaaagcaaaggctatactattgcgaataaa
aaagaagatatccaaaagcttgattcctcatctaacaaggtatatgctgtaactccagta
acagaagattctggatcaatgccttatacaatagatactaaagacggcgacttaactcta
gcagattatgtttctaaaggcatagatatattagacaatgataaaggtttcttcttaatg
tgtgaatcaggtaaaatcgactgggcgtgtcacgctaacgatgctatgagcgcaattaaa
gaagttattggtttagaaagtgctgttcaaaaggctatagatttcgctggaaaacatcct
gatgaaactttaattcttgtaactggtgaccatgagactggtggtatgacaataggatat
gccgctactggttataacactgcctttaacattctagacaagcaaaaaatctcttacatt
gcctttgatactttaataagcaagaagaaagaagcaaacccaaatatatctttcgaagaa
gttatgccaatgattaaagaaaattttggactgattgccccaggtgatgctgatgccaat
gttgaagcaaacaaaccatatgttctaactagctatgaatatcaaaagctccaaaatgct
tttgctgaatctatgaaaaaagcagatcaacgtacaaaaaatgaagagacagcagttctt
tatggagaatacgatccactttctgtcactatcacccatattataaataataaagctgga
ataggctggacttcttattctcatacaggtacaccagtaccagtttacgcttatggagct
tcttccgaaatttttgaaggttcatatgataatactgatatcttcaaaaaactagttgat
gtttgcaaagtaaaataa

DBGET integrated database retrieval system