KEGG   Clostridium cellulovorans: Clocel_2800Help
Entry
Clocel_2800       CDS       T01294                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ccb  Clostridium cellulovorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clocel_2800
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clocel_2800
   00600 Sphingolipid metabolism
    Clocel_2800
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Clocel_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3417596..3419788)
Genome map
AA seq 730 aa AA seqDB search
MGIIFQEKGNIFKLDAKDTSYIIQITEKGYLQHVYWGKKVRSLNLKYISRFYGEQNSKAL
EEGVINNFSLDYMPAEYPAYGNQDFRSPAYQVQLENGSTISDLRYESHNIFSGKKKLQGL
PAVYVEKDEEADSLEVVLRDSVSGLKVVLTYTAFKDYDVITRSAQLINEGKEELKILRAL
SANVDLGCKDFQMLQLSGSWSRERHVVKRPVVMGIQSIESRRGVSSHQQNPFIALMKGDA
DEDHGDVYGFNLVYSGNFLANVELEQFDLTRVQIGINPFDFTWLLKEGESFQAPEAVLVY
SDEGLGKMSRTFHKLYRNRMCRGVHRDKERPVLINNWEGTYFNFNEEIIKKIATEAKELG
VELFVLDDGWFGKRNDDTTSLGDWFVDKNKLPNGLDNLAKYINEQGIKFGLWFEPEMVSP
DSDLYRKHPDWCIHVENREKTLARTQLVLDLSRKDVCDAIVKMVSDILDSVPISYVKWDN
NRYMTEVGSATLPAERQRETAHRYMLGFYSVLEAITTRFPEILFESCASGGGRFDPAMLY
YMPQTWASDDTDAVERLKIQYGTSIVYPSITMGAHVSAVPNHQVNRITPLETRGNVAMSG
TFGYELDVTKMSDEEKETVRQQIITYKEIRTLVQFGDFYRLLSPFEGNETAWMFVAEDKS
DVAASFFKVLSSSHKKLSVLKLKGLDPNKDYLLIGTDEVYGGDELMNTGLVIPELKGDFQ
SYMWRLKEIK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgggtattatatttcaagaaaagggcaacatatttaaattagatgctaaagatactagc
tatatcattcagataacagaaaagggttatttgcaacatgtttattggggcaaaaaggtt
agaagtttaaatttaaaatacatatcaagattttatggagagcagaatagtaaagctctt
gaagaaggtgtaataaataatttttcattagactatatgccagcagagtatcctgcttat
ggtaatcaagattttcgttcacctgcatatcaagttcagctagaaaatggttcaactatt
tcagatttaagatatgagagtcataatatattttctggtaagaaaaagcttcaaggacta
ccagcagtttacgtagaaaaagatgaggaagcagattcccttgaagttgtactaagggat
agtgttagtgggcttaaagttgtgttaacatatactgcatttaaggattatgatgttata
acaaggtcagctcagcttattaatgaagggaaagaagaattaaaaatattaagagcatta
agtgctaatgtagatttaggatgcaaggactttcaaatgcttcagttgtcaggatcttgg
agtagagaacgacatgttgttaaaagacctgtggtaatgggaattcaatctatagaaagt
agaagaggtgtaagtagccatcaacagaatccgtttattgctcttatgaaaggtgatgct
gatgaagatcatggtgatgtttatggatttaatttagtatatagtggaaactttttagca
aatgttgagttagaacaatttgatttaacaagagttcaaattggcataaatccatttgat
tttacttggcttcttaaggaaggggaaagtttccaagctccagaagcagtacttgtttac
tcagatgaaggcttaggaaagatgtctagaacttttcataagttatatagaaatagaatg
tgtagaggagttcatagagataaagaaagaccagttcttattaataattgggaagggact
tactttaattttaatgaagaaataattaagaaaatcgctacagaagctaaggaacttggt
gttgaactttttgtattagatgatggatggtttggaaaaagaaatgacgatactacttca
cttggtgattggtttgttgataaaaataaattacctaatggacttgataatttagcaaag
tatatcaatgaacaaggaataaaattcgggctatggtttgaacctgagatggtttctcca
gatagtgatttatatagaaagcatccagattggtgcatacatgttgaaaatagagagaaa
actttagctagaacacagttagttttagacttatcaagaaaagacgtatgtgatgctata
gttaaaatggtatcagatattttagattcagttcctatttcctatgttaagtgggataat
aacagatatatgactgaagtagggtcagcgacattgccagctgaaagacaaagagaaaca
gctcatagatatatgttagggttttatagtgtattagaagctataacaactaggtttcca
gaaatacttttcgaaagttgtgcaagtggtggtggaagatttgatccggcaatgctttac
tatatgcctcagacttgggctagtgacgacactgatgcagttgaaagattaaagattcaa
tatggaacaagtatagtatatccaagtattactatgggagctcatgtgtcagcagtacca
aatcatcaggtgaatagaataactccattagaaacaagagggaatgttgcaatgagtggc
acctttgggtatgagttggatgttacaaagatgtcagatgaagaaaaagaaactgtgaga
caacaaataataacatataaggaaatacgaactctagtgcagtttggagatttttataga
ttacttagcccattcgaaggaaatgaaactgcatggatgtttgtagcagaagataagagt
gatgttgctgcaagtttctttaaggttctttcttcaagtcataagaaacttagtgtgcta
aaacttaaaggattagatccaaataaagattacttattaattggaactgatgaagtttat
ggtggagatgaattaatgaatactggacttgttattccagagttaaaaggtgacttccaa
agctatatgtggagattgaaagaaataaaataa

DBGET integrated database retrieval system