KEGG   Clostridium cellulovorans: Clocel_2800Help
Entry
Clocel_2800       CDS       T01294                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ccb  Clostridium cellulovorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ccb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ccb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ccb00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3417596..3419788)
Genome map
AA seq 730 aa AA seqDB search
MGIIFQEKGNIFKLDAKDTSYIIQITEKGYLQHVYWGKKVRSLNLKYISRFYGEQNSKAL
EEGVINNFSLDYMPAEYPAYGNQDFRSPAYQVQLENGSTISDLRYESHNIFSGKKKLQGL
PAVYVEKDEEADSLEVVLRDSVSGLKVVLTYTAFKDYDVITRSAQLINEGKEELKILRAL
SANVDLGCKDFQMLQLSGSWSRERHVVKRPVVMGIQSIESRRGVSSHQQNPFIALMKGDA
DEDHGDVYGFNLVYSGNFLANVELEQFDLTRVQIGINPFDFTWLLKEGESFQAPEAVLVY
SDEGLGKMSRTFHKLYRNRMCRGVHRDKERPVLINNWEGTYFNFNEEIIKKIATEAKELG
VELFVLDDGWFGKRNDDTTSLGDWFVDKNKLPNGLDNLAKYINEQGIKFGLWFEPEMVSP
DSDLYRKHPDWCIHVENREKTLARTQLVLDLSRKDVCDAIVKMVSDILDSVPISYVKWDN
NRYMTEVGSATLPAERQRETAHRYMLGFYSVLEAITTRFPEILFESCASGGGRFDPAMLY
YMPQTWASDDTDAVERLKIQYGTSIVYPSITMGAHVSAVPNHQVNRITPLETRGNVAMSG
TFGYELDVTKMSDEEKETVRQQIITYKEIRTLVQFGDFYRLLSPFEGNETAWMFVAEDKS
DVAASFFKVLSSSHKKLSVLKLKGLDPNKDYLLIGTDEVYGGDELMNTGLVIPELKGDFQ
SYMWRLKEIK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgggtattatatttcaagaaaagggcaacatatttaaattagatgctaaagatactagc
tatatcattcagataacagaaaagggttatttgcaacatgtttattggggcaaaaaggtt
agaagtttaaatttaaaatacatatcaagattttatggagagcagaatagtaaagctctt
gaagaaggtgtaataaataatttttcattagactatatgccagcagagtatcctgcttat
ggtaatcaagattttcgttcacctgcatatcaagttcagctagaaaatggttcaactatt
tcagatttaagatatgagagtcataatatattttctggtaagaaaaagcttcaaggacta
ccagcagtttacgtagaaaaagatgaggaagcagattcccttgaagttgtactaagggat
agtgttagtgggcttaaagttgtgttaacatatactgcatttaaggattatgatgttata
acaaggtcagctcagcttattaatgaagggaaagaagaattaaaaatattaagagcatta
agtgctaatgtagatttaggatgcaaggactttcaaatgcttcagttgtcaggatcttgg
agtagagaacgacatgttgttaaaagacctgtggtaatgggaattcaatctatagaaagt
agaagaggtgtaagtagccatcaacagaatccgtttattgctcttatgaaaggtgatgct
gatgaagatcatggtgatgtttatggatttaatttagtatatagtggaaactttttagca
aatgttgagttagaacaatttgatttaacaagagttcaaattggcataaatccatttgat
tttacttggcttcttaaggaaggggaaagtttccaagctccagaagcagtacttgtttac
tcagatgaaggcttaggaaagatgtctagaacttttcataagttatatagaaatagaatg
tgtagaggagttcatagagataaagaaagaccagttcttattaataattgggaagggact
tactttaattttaatgaagaaataattaagaaaatcgctacagaagctaaggaacttggt
gttgaactttttgtattagatgatggatggtttggaaaaagaaatgacgatactacttca
cttggtgattggtttgttgataaaaataaattacctaatggacttgataatttagcaaag
tatatcaatgaacaaggaataaaattcgggctatggtttgaacctgagatggtttctcca
gatagtgatttatatagaaagcatccagattggtgcatacatgttgaaaatagagagaaa
actttagctagaacacagttagttttagacttatcaagaaaagacgtatgtgatgctata
gttaaaatggtatcagatattttagattcagttcctatttcctatgttaagtgggataat
aacagatatatgactgaagtagggtcagcgacattgccagctgaaagacaaagagaaaca
gctcatagatatatgttagggttttatagtgtattagaagctataacaactaggtttcca
gaaatacttttcgaaagttgtgcaagtggtggtggaagatttgatccggcaatgctttac
tatatgcctcagacttgggctagtgacgacactgatgcagttgaaagattaaagattcaa
tatggaacaagtatagtatatccaagtattactatgggagctcatgtgtcagcagtacca
aatcatcaggtgaatagaataactccattagaaacaagagggaatgttgcaatgagtggc
acctttgggtatgagttggatgttacaaagatgtcagatgaagaaaaagaaactgtgaga
caacaaataataacatataaggaaatacgaactctagtgcagtttggagatttttataga
ttacttagcccattcgaaggaaatgaaactgcatggatgtttgtagcagaagataagagt
gatgttgctgcaagtttctttaaggttctttcttcaagtcataagaaacttagtgtgcta
aaacttaaaggattagatccaaataaagattacttattaattggaactgatgaagtttat
ggtggagatgaattaatgaatactggacttgttattccagagttaaaaggtgacttccaa
agctatatgtggagattgaaagaaataaaataa

DBGET integrated database retrieval system