KEGG   Clostridium cellulovorans: Clocel_2873Help
Entry
Clocel_2873       CDS       T01294                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clocel_2873
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocel_2873
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clocel_2873
Enzymes [BR:ccb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clocel_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3542037..3543518
Genome map
AA seq 493 aa AA seqDB search
MEYKSTRTKTQPISSSEAIIKGISQDGGLYVPVEIPKLDIPVASLKDLEYKDLAFDIMKR
FFTDLNQEDLKNSIYNAYDEKFDTPTIVPITYKDGAHFLELFHGPTLAFKDMALSILPEL
MNLSLKKQEVKKEIVILTATSGDTGKAALEGFANKESIKIVVFFPKDGVSEIQKLQMITQ
EGDNTFVVAIEGNFDDAQSGVKTIFNDKAFAEKLESENFLLSSANSINIGRLVPQIVYYF
YGYLNLLKNNKIADGEKINVVVPTGNFGNILAAYYAKIMGLPINKFICASNDNNVLYDFF
TTGIYDKNRDLKITTSPSMDILLSSNLERLLYTISGEDEALVAKMMSDLNSTGKYEITPA
MKEALTDFYGGFATEAEVNASILDIYNKEKYVIDTHTAVAMHVYKKYVAETNDTTQTLIA
STASPFKFSTNVASALGIDVANITDFEAVNKLSETCGIEIPDRVSKLLNMEIKHNNSCTK
TEMKSIIEKFLKL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaaaagcactcgaactaaaactcaacctatttcttcaagcgaagcaattatt
aaaggtatttctcaggatgggggcttatatgttcctgttgaaattccaaaattagatatt
ccagttgcatcattaaaagacttggaatataaggatctagcatttgatataatgaagaga
ttttttactgatcttaatcaagaagatttaaaaaattctatatataatgcttatgatgaa
aaatttgataccccaacaatcgtgcctatcacatataaagatggtgcgcacttcttagaa
ctttttcatggaccaactcttgcttttaaagacatggctctttcaatacttcctgagctt
atgaacttatctttaaagaaacaagaagtaaaaaaagaaattgtaatattgactgcaact
tctggtgatactggtaaagccgcattagaaggttttgctaataaagaatccatcaagata
gttgtattcttccctaaggatggagtaagtgaaatccaaaaacttcaaatgataactcaa
gaaggagataacacttttgttgttgctattgaaggtaattttgatgatgcacaaagtggt
gtaaaaactattttcaacgataaagcatttgcagaaaaattagaaagtgaaaacttccta
ttatcttcagcaaattcaatcaacatcggaagactagttccccaaatcgtgtactacttc
tatggctatttaaaccttcttaagaataacaaaatagctgatggtgaaaaaatcaatgta
gttgtaccaactggtaattttggtaatatcctagcagcatattatgcaaaaattatggga
ttacctatcaataaattcatttgtgcatcaaatgataacaacgttttatatgatttcttt
actacaggaatttacgataaaaatagagaccttaaaattacaacttctccatcaatggat
atcttactttcaagtaatcttgaaagattattatatacaatcagcggtgaagatgaagct
ttagttgctaaaatgatgtcagatttaaattctactggcaaatatgaaatcactcctgct
atgaaggaagctcttaccgacttctatggaggatttgcaacagaagctgaagttaatgca
tcaatcttagatatatacaataaagaaaaatatgtaattgatactcatactgctgttgca
atgcacgtatataaaaagtatgtagcagaaacaaatgatacaacacaaactttaattgct
tcaactgctagcccattcaagtttagcactaacgttgcttcagctttaggaatcgatgtt
gccaatataacagacttcgaagcagttaataaactatcagaaacctgtggtattgaaatt
ccagatagagtttcaaagttattaaacatggaaattaaacataataattcatgtacgaag
actgagatgaaatctattatagaaaaatttttaaaactgtag

DBGET integrated database retrieval system