KEGG   Clostridium cellulovorans: Clocel_2882Help
Entry
Clocel_2882       CDS       T01294                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ccb  Clostridium cellulovorans
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocel_2882
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Clocel_2882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3550721..3552157)
Genome map
AA seq 478 aa AA seqDB search
MIHKHLKPFPKNFLWGSATAAYQIEGAYNEDGKGISVWDEYVRAENRTYKNTNGDVAVDH
YHRYKEDVALMAEMGLKAYRFSIAWTRIFPEGRGEVNEKGLEFYDNLINELIKYNIEPIV
TIYHWDAPQKLMDLYGAWESREIIEDFNNYCVTLFKKFGDRVKYWVTLNEQNVFIGHGYR
GAMHPPGVSDLKRMYEANHIANLANAKAICSFKQYVPDGKVGPSFAYTPAYPFSCKPEDI
LAYENAEEYNSHWWLEVYCNGEYPKAIWNYLEEKGLTPTIEEGDFELLKQGKPDFLGMNY
YRSETYEMNPLDGVGAGKVNTSGKKGTTEESGVPGLYKTKKNPNLKATNWDWEIDPEGLR
ISLRRLTNRYGLPVLITENGLGEFDKLTEDKQIFDDYRIDYLRSHIEACQEAITDGVELI
GYCTWSFTDLLSWLNGYQKRYGFVYVNRDEESEKDLARIPKKSFYWYRDVIQSNGEKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgatacacaagcatttgaagccattcccgaaaaattttctttggggatctgcaacagca
gcataccaaatagaaggtgcctataacgaagatggtaaagggatttctgtatgggatgaa
tatgttagagcagagaatcgtacttacaaaaacactaacggtgatgtagcagtagatcac
taccatagatataaagaagacgttgccttaatggcagaaatgggattaaaggcatacaga
ttctctatagcgtggacaagaatttttccagaaggtagaggcgaagtaaacgaaaaaggt
ttagagttttatgataaccttattaatgaacttatcaagtataatattgaaccaattgta
actatttatcactgggatgctccgcagaagcttatggatttatatggtgcatgggagtca
agagaaattatagaagattttaataattattgcgtaaccttattcaaaaagtttggtgac
agagttaagtattgggttacattaaatgaacaaaacgtatttataggtcatggttataga
ggagctatgcacccaccaggagtaagtgatttaaagagaatgtatgaagctaatcatatt
gcaaacttagcaaatgctaaagctatctgttcttttaaacaatatgttcctgatggaaaa
gttgggccaagctttgcatatacaccagcatatccattctcatgtaaaccagaagatatc
ttagcttatgaaaatgcagaagagtataatagtcattggtggcttgaagtttattgtaat
ggtgaatatcctaaagcgatttggaactatcttgaagaaaaaggacttaccccaactata
gaagaaggggactttgagcttttgaaacaaggaaaacctgacttcttaggaatgaattat
tatagatcagaaacttatgaaatgaatcctttagatggcgttggtgctggaaaggttaac
acttcaggcaaaaaaggaacaactgaagaatcaggagtaccaggactatacaaaactaag
aaaaatccaaatcttaaagcaacaaattgggattgggaaatcgatccagaaggtttgaga
atcagtttaagaagacttacaaatagatatggattgcctgtactaattacagaaaacggt
ttaggtgagtttgataaacttactgaggacaagcaaatatttgatgattacagaattgat
tacttaagatctcacattgaagcttgtcaagaagctataacagacggagtagaacttatt
ggttactgcacgtggtcatttacagatttattaagttggttaaatggttaccaaaaacgt
tatggttttgtttatgtaaacagagatgaggaaagtgaaaaggatttagctcgtatacct
aaaaagagtttttattggtatagagatgttatccaaagcaatggtgaaaagctataa

DBGET integrated database retrieval system