KEGG   Clostridium cellulovorans: Clocel_2900Help
Entry
Clocel_2900       CDS       T01294                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ccb  Clostridium cellulovorans
Brite
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clocel_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3575410..3577233
Genome map
AA seq 607 aa AA seqDB search
MNLSKRLLSCVLSAGIVASAFAVATPVYAEDALLISSTFEGGTDGWSTMGTTTISPSTLS
HSGNGSLYVSGRAASWAGPCNIRTDVLKAGNTYNLSSYVMYNDASAADTQPISFMLKYTD
STNKAFYVPIATVTVNKGEWTKIENTAYKIPAEATSAMIYWETTGTMINYYVDDVTAYGP
STFNPNVTAATPLKNVFGKYFDIGCAATPSEVSLQVAKDLVKTHYNNLTIGNELKPDYVL
DKAACQASGNNVNPQVKLDSARSLLKYCAENNIEVRGHVLVWHSQTPSWFFKENFSDTGA
TVSKDVMNQRLENYIKNLFAAINAEFPTLKIYAWDVVNECYLDGGNLRTAGFPETAGKEA
SAWNLVYGDDSYIDNAFTYARKYAPAGVKLFYNDFNEYIQSKRNAIYTMAMRLKSKGIID
GIGMQSHLDMGFPDTNTYKAALTKFGSTGLEVQVTELDITTSDTSATGLANQATKYAAIM
QSILDAKKAGTANITNVVFWGITDGTSWRATRLPLLFDGNYYPKPAFDSVVKLVPTSDYY
TPGYALGDVNNDGKINALDLALVKKGLLSEFTDPAAKVAADVNKDGNTNAIDLALLKKYL
LGQITSF
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaagtaaaagattattatcttgtgttctatctgctggtatagtggcttcagca
tttgcagttgctacaccagtatatgctgaagatgctctattaataagtagcaccttcgaa
ggaggtacagatggttggtcaactatgggtacaactactatttcaccaagtactttaagc
catagcggtaacggaagcctctacgtttctggtagagctgcttcatgggctggaccatgc
aatataagaacagacgtattgaaagcaggaaatacatataaccttagttcctatgtaatg
tacaatgatgctagtgctgcagatactcaacctattagcttcatgttaaagtacacagat
tctacaaataaagctttctatgtacctatcgcaactgtaactgtaaacaaaggtgaatgg
acaaaaatcgaaaataccgcttataaaatcccagcagaagcaactagtgcaatgatttat
tgggaaactacaggtacaatgattaactactatgtcgacgacgttacagcatatggtcca
agcacatttaatcctaatgtaactgcagctacaccacttaaaaacgtatttggaaaatac
tttgatataggttgcgctgcgacaccttctgaagtatctttacaagttgctaaagatctt
gtaaaaactcactacaacaaccttactataggaaatgagcttaaaccagattatgtatta
gataaagctgcttgccaagcatccggtaacaatgtaaaccctcaagttaaattagacagt
gcacgtagtcttttaaaatactgtgctgagaacaatatagaagtaagaggccacgtttta
gtatggcatagtcaaactccttcttggttctttaaagaaaacttcagtgacactggagct
actgtatcaaaagacgtcatgaatcaacgtcttgaaaactatataaagaatctttttgca
gcaattaacgcagagttccctacattaaagatttatgcatgggacgttgtaaatgaatgt
tacctagatggtggtaatctacgtactgcaggatttcctgaaactgctgggaaagaagca
tctgcatggaatttagtctatggtgatgactcatacatagacaatgctttcacatatgca
agaaaatatgctccagctggtgttaagttattctacaacgactttaacgaatatatacaa
tcaaaacgtaacgcaatctacactatggcaatgagattaaaatctaaaggtattatcgat
ggtatcggtatgcaatctcacctagatatgggctttcctgatacaaatacttataaagca
gcactaactaaattcggttcaactggcttagaagttcaagttacagaacttgatataact
acaagtgatacaagtgctacaggactagcaaatcaagctactaaatatgcagctattatg
caaagtattttagatgcaaaaaaagcaggtactgctaacattacaaacgttgtattctgg
ggtattactgatggaacaagctggcgtgcaacaagattaccattgctattcgatggaaac
tactatccaaaaccagctttcgattcagttgttaaattagttcctacaagcgactactat
actcctggttatgccttaggtgatgtaaacaatgacggtaaaatcaatgctctagatctt
gcattagtgaaaaaaggtctattaagtgaatttacagatccagctgcaaaagtagctgca
gatgtaaacaaagatggtaatactaatgctatcgaccttgcattattaaagaaatatctt
ctaggacaaattactagtttctaa

DBGET integrated database retrieval system