KEGG   Clostridium cellulovorans: Clocel_3039Help
Entry
Clocel_3039       CDS       T01294                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ccb  Clostridium cellulovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clocel_3039
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clocel_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3733168..3735381)
Genome map
AA seq 737 aa AA seqDB search
MIEIQGTVEAIVFQNEDNGYVVATIKYDDNKATIVGVIPYIVEGQTLKLKGQWINHKKFG
QQFKVEECEEVLPDSVIGIERYLSSGVVQGIGPVTARKIVQHFGNDALRIMEEDIERLKE
IEGIGAKKIKVIAESFATQRDIRAIMVFLQTYGVTPTQCNKIYKRFGNAAIEMVKNNPYI
LTEEISGIGFRTADKIARSLGIELNSPYRIQSGIIYLVKHFSLLGNTYMPLHKLISEGKD
ILSVDALEIEKNLQECILDLKLKVEEFNQELCVFDLPYYYSELSVTSKLLTLATSSYDEL
KIDIDVEIKEFEEKNNIVFAESQKEAVRGAIENGIEVITGGPGTGKTTIINCINSIFEKH
SLKISMAAPTGRAAKRMTESTGREAKTIHRLLELGFSEDEGNSEFIRNEESPLKCDVLIV
DEASMIDIMLMSNLLKAVELGTRIIIVGDVDQLPSVGPGNVLRDIIDSNAVKVVRLKEIF
RQSKESMIIVNAHMINNGKIPVLNSKDKDFFFITKESPNDILEEIKGLIYKRLPSFNKKW
DNIKHIQILTPMRRGVLGVETLNGQLQEILNPYSSIKKEIEFRNTVFRIGDKVMQTKNNY
QIKWERISGNGEYDGMGIFNGDIGYIDDIDEENNRLHIIFDDERLVKYEDCYFDELELAY
AMTIHKSQGSEFPVVIMPMFMGAPMLMNRNLLYTGVTRAKEMVVLVGNKKALNFMVENTN
SVERYSGLCYRITDILG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattcaaggtactgttgaagctattgtctttcaaaatgaagataatggatat
gtagttgcaacaattaaatatgacgataataaagctacgattgtaggggttataccttat
atagtagaaggtcaaaccttaaagcttaaaggtcaatggattaatcataagaaatttgga
cagcagtttaaggttgaggaatgtgaagaggtattaccggattctgttattggtattgaa
cgatatctttcttcaggagtagttcaaggaataggaccagtgacagcgagaaaaatagtt
cagcattttggaaatgatgctttgagaattatggaagaagatattgaacggcttaaagaa
attgaaggaataggcgcaaagaaaatcaaggtcatagctgagtcttttgctactcaaaga
gatataagagctataatggtgtttcttcaaacttatggagtcaccccaactcaatgcaat
aagatttataaaagatttggcaatgcagctatagaaatggtgaaaaataatccttacata
ttgacagaggagataagtggaatagggtttagaacagcagataaaatagctaggagtcta
ggcattgaacttaattcaccttacagaattcagagtggcataatatatttagtaaaacat
ttttctttgcttggcaacacatacatgcctcttcataaattgataagtgagggaaaagat
atattaagtgttgatgcccttgaaatagaaaaaaatctacaggaatgtatcttagattta
aagctaaaagttgaggaatttaatcaagaattgtgcgtgtttgatcttccttattattat
agtgaactttcagtaacctcaaaacttttgactttagcaacatcgtcttatgatgaactt
aaaatagatatagatgtagagataaaagagtttgaagaaaaaaataatatagtatttgca
gaatcgcagaaagaggctgtgagaggtgctatagaaaatggaattgaagtaattacagga
ggaccagggactggcaaaaccacgataataaattgtataaacagtatttttgagaagcac
tcattaaagatttctatggcagcacctactggaagagctgcaaagagaatgacagaatct
acagggagagaagctaaaaccattcatagattgttagaattagggtttagtgaagatgag
ggaaattcagaatttattagaaatgaagaatctccattaaagtgtgatgtgttaattgta
gatgaagcatcgatgatagatattatgttaatgagcaatttactaaaggctgtggaatta
ggaacaagaattattattgttggagatgtagaccaacttccatcagtaggaccaggtaat
gtccttagagatattatagatagtaatgctgtaaaggtagttagattaaaagaaatattt
agacaaagtaaagagagtatgataattgtaaatgctcacatgataaataatgggaaaatt
ccagtgttgaattcaaaggataaggatttcttcttcataacaaaggaatcgccaaatgat
atacttgaagaaataaaagggttaatatataaaaggttaccttctttcaataaaaagtgg
gataatataaagcatattcaaattttaaccccaatgaggcgaggcgttcttggtgttgaa
actctcaatggacaattacaggaaatcttaaatccttatagcagtataaagaaagaaatt
gaatttagaaacactgtttttagaattggtgataaagttatgcagactaagaataattat
caaataaaatgggaaagaatatctggaaatggtgaatatgatggaatggggatttttaat
ggtgatataggatatattgacgatattgatgaagaaaataatagattgcatataattttt
gatgatgaaagattagtaaaatatgaagattgctattttgatgaactggaacttgcatat
gctatgactatccataaaagtcaaggtagtgaattcccagtagtaattatgccaatgttt
atgggagcacccatgcttatgaatagaaatcttttgtatactggtgtaactagagcgaag
gaaatggtagttttagtgggaaataaaaaagccttgaactttatggttgaaaatactaat
agtgttgaaagatattctggcttatgttataggattacagatatattggggtga

DBGET integrated database retrieval system