KEGG   Clostridium cellulovorans: Clocel_3039Help
Entry
Clocel_3039       CDS       T01294                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clocel_3039
Enzymes [BR:ccb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clocel_3039
DNA repair and recombination proteins [BR:ccb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Clocel_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Helicase_RecD AAA_11 Viral_helicase1 UvrD_C PIF1 HHH_2 PhoH T2SSE AAA_23 RsgA_GTPase AAA_22 DUF2075 AAA_28 DEAD HHH_3 AAA AAA_29 ABC_ATPase NTPase_1 AAA_16 AAA_12 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ADL52729
JGI: Clocel_3039
UniProt: D9STJ5
Position
complement(3733168..3735381)
Genome map
AA seq 737 aa AA seqDB search
MIEIQGTVEAIVFQNEDNGYVVATIKYDDNKATIVGVIPYIVEGQTLKLKGQWINHKKFG
QQFKVEECEEVLPDSVIGIERYLSSGVVQGIGPVTARKIVQHFGNDALRIMEEDIERLKE
IEGIGAKKIKVIAESFATQRDIRAIMVFLQTYGVTPTQCNKIYKRFGNAAIEMVKNNPYI
LTEEISGIGFRTADKIARSLGIELNSPYRIQSGIIYLVKHFSLLGNTYMPLHKLISEGKD
ILSVDALEIEKNLQECILDLKLKVEEFNQELCVFDLPYYYSELSVTSKLLTLATSSYDEL
KIDIDVEIKEFEEKNNIVFAESQKEAVRGAIENGIEVITGGPGTGKTTIINCINSIFEKH
SLKISMAAPTGRAAKRMTESTGREAKTIHRLLELGFSEDEGNSEFIRNEESPLKCDVLIV
DEASMIDIMLMSNLLKAVELGTRIIIVGDVDQLPSVGPGNVLRDIIDSNAVKVVRLKEIF
RQSKESMIIVNAHMINNGKIPVLNSKDKDFFFITKESPNDILEEIKGLIYKRLPSFNKKW
DNIKHIQILTPMRRGVLGVETLNGQLQEILNPYSSIKKEIEFRNTVFRIGDKVMQTKNNY
QIKWERISGNGEYDGMGIFNGDIGYIDDIDEENNRLHIIFDDERLVKYEDCYFDELELAY
AMTIHKSQGSEFPVVIMPMFMGAPMLMNRNLLYTGVTRAKEMVVLVGNKKALNFMVENTN
SVERYSGLCYRITDILG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattcaaggtactgttgaagctattgtctttcaaaatgaagataatggatat
gtagttgcaacaattaaatatgacgataataaagctacgattgtaggggttataccttat
atagtagaaggtcaaaccttaaagcttaaaggtcaatggattaatcataagaaatttgga
cagcagtttaaggttgaggaatgtgaagaggtattaccggattctgttattggtattgaa
cgatatctttcttcaggagtagttcaaggaataggaccagtgacagcgagaaaaatagtt
cagcattttggaaatgatgctttgagaattatggaagaagatattgaacggcttaaagaa
attgaaggaataggcgcaaagaaaatcaaggtcatagctgagtcttttgctactcaaaga
gatataagagctataatggtgtttcttcaaacttatggagtcaccccaactcaatgcaat
aagatttataaaagatttggcaatgcagctatagaaatggtgaaaaataatccttacata
ttgacagaggagataagtggaatagggtttagaacagcagataaaatagctaggagtcta
ggcattgaacttaattcaccttacagaattcagagtggcataatatatttagtaaaacat
ttttctttgcttggcaacacatacatgcctcttcataaattgataagtgagggaaaagat
atattaagtgttgatgcccttgaaatagaaaaaaatctacaggaatgtatcttagattta
aagctaaaagttgaggaatttaatcaagaattgtgcgtgtttgatcttccttattattat
agtgaactttcagtaacctcaaaacttttgactttagcaacatcgtcttatgatgaactt
aaaatagatatagatgtagagataaaagagtttgaagaaaaaaataatatagtatttgca
gaatcgcagaaagaggctgtgagaggtgctatagaaaatggaattgaagtaattacagga
ggaccagggactggcaaaaccacgataataaattgtataaacagtatttttgagaagcac
tcattaaagatttctatggcagcacctactggaagagctgcaaagagaatgacagaatct
acagggagagaagctaaaaccattcatagattgttagaattagggtttagtgaagatgag
ggaaattcagaatttattagaaatgaagaatctccattaaagtgtgatgtgttaattgta
gatgaagcatcgatgatagatattatgttaatgagcaatttactaaaggctgtggaatta
ggaacaagaattattattgttggagatgtagaccaacttccatcagtaggaccaggtaat
gtccttagagatattatagatagtaatgctgtaaaggtagttagattaaaagaaatattt
agacaaagtaaagagagtatgataattgtaaatgctcacatgataaataatgggaaaatt
ccagtgttgaattcaaaggataaggatttcttcttcataacaaaggaatcgccaaatgat
atacttgaagaaataaaagggttaatatataaaaggttaccttctttcaataaaaagtgg
gataatataaagcatattcaaattttaaccccaatgaggcgaggcgttcttggtgttgaa
actctcaatggacaattacaggaaatcttaaatccttatagcagtataaagaaagaaatt
gaatttagaaacactgtttttagaattggtgataaagttatgcagactaagaataattat
caaataaaatgggaaagaatatctggaaatggtgaatatgatggaatggggatttttaat
ggtgatataggatatattgacgatattgatgaagaaaataatagattgcatataattttt
gatgatgaaagattagtaaaatatgaagattgctattttgatgaactggaacttgcatat
gctatgactatccataaaagtcaaggtagtgaattcccagtagtaattatgccaatgttt
atgggagcacccatgcttatgaatagaaatcttttgtatactggtgtaactagagcgaag
gaaatggtagttttagtgggaaataaaaaagccttgaactttatggttgaaaatactaat
agtgttgaaagatattctggcttatgttataggattacagatatattggggtga

DBGET integrated database retrieval system