KEGG   Clostridium cellulovorans: Clocel_3070Help
Entry
Clocel_3070       CDS       T01294                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ccb  Clostridium cellulovorans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Clocel_3070
Enzymes [BR:ccb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Clocel_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3763123..3763716)
Genome map
AA seq 197 aa AA seqDB search
MYRPTDHGWIEVVCGPMYSGKSEELIRRVKRARIGNLKVQVFKPAIDNRYDDEAVVSHCG
ERVDGVAVSSSREILELLEDDTKVVAIDEVQFFDDELVDVVSELANEHKRIICAGLDTDF
RGEPFGIMPKLMAIAEFVDKITAICMKCGNPATRTQRLINGMPAKYEDKIVLIGATESYE
ARCRNCHQVPREGELYE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtatagacctacggatcatggttggattgaagtagtatgtggacctatgtatagtggt
aaatcagaagaacttatcagaagggtaaaaagagctaggataggtaatctaaaggtgcaa
gtttttaaacctgctattgataataggtatgatgatgaagctgtggtttcacattgtgga
gaaagagttgatggagtggctgtcagttcttctagagaaatattagaactattagaagat
gatacaaaggtcgtagctatagatgaggttcagttttttgatgatgaattagttgatgtt
gtttctgaacttgcaaatgaacataaaagaataatatgtgcaggattggatacggatttt
agaggggaaccctttgggattatgcctaagcttatggctattgctgaattcgttgataag
ataaccgctatatgtatgaagtgtggaaatcctgctacaaggactcaaagattaattaac
ggaatgccagctaaatatgaagataaaatagttttgattggggcaacggaatcctatgag
gcaagatgtagaaactgtcatcaggtgccacgagaaggagaattatatgagtaa

DBGET integrated database retrieval system