KEGG   Clostridium cellulovorans: Clocel_3354Help
Entry
Clocel_3354       CDS       T01294                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ccb  Clostridium cellulovorans
Pathway
ccb00500  Starch and sucrose metabolism
ccb01100  Metabolic pathways
ccb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clocel_3354
Enzymes [BR:ccb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Clocel_3354
Exosome [BR:ccb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clocel_3354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 Alpha-amylase_C Glyco_hydro_70 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADL53034
JGI: Clocel_3354
UniProt: D9SV60
Position
complement(4102277..4104076)
Genome map
AA seq 599 aa AA seqDB search
MKLQDFYEGKSFDAYEYFGAHKESNGFTFRTYAPRAKHVTIIGEFNNWQEEAMSQEFQSG
VFSISGVSADYGMMYKYCIYTEDGRRDEHCDPYGFFMELRPGTCSITTDLNSYSFNDEEW
MKNRSVNYDKPLNIYELHLGSWKKKTDEEEGWYSYSEIADLIIDYVREDGYTHIEIMPLS
EHPCDESWGYQNTGFFAPTARYGTPDQLKEMIDKLHQSGIGVILDFVPVHFAIDAYGLRN
YDGTCLYEYPSTDVGTSEWGSYNFIYSRREVRCFMQSAANYWLKEFHFDGLRMDAVSRLI
YWQGDEKRGENGQSIEFLKVMNSGLKSIHPTAMLIAEDSSAYEGVTRPVELNGLGFDYKW
DLGWMHDTLEYFQTAPEYRARDYHKLTFSMLYFYSEKYLLALSHDEVVHGKATIMQKMSG
YYEDKFPQARAMYLYMIMHPGKKLNFMGNEIGQLREWNEKREQDWDILQYPVHDCYHQYT
LNLNQIYKYYEPLHDDYSLHNFKWIDCEQNDKCIYTIARTGVKQTLLAVFNFGNEDCENY
YITLKEGQEVKLILHSNWERYSGTVSETEEFYKINDEDDIIELSMEVAKFSGILFEIID
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcaggatttttatgagggaaaatcttttgatgcatatgagtattttggcgct
cataaagaaagtaacggatttacttttcgtacctatgcaccaagagcaaaacatgtaacg
ataataggtgaatttaataattggcaagaagaggctatgagtcaagaatttcaaagtggt
gtcttttctattagtggagtttcggcagattacggtatgatgtataagtattgcatttat
acagaagacggaagaagagatgagcattgtgatccatatgggttctttatggagttaagg
cctggtacttgttccattactacagatttaaactcatatagttttaacgatgaggaatgg
atgaaaaatcgtagtgttaactatgataaacctcttaacatatatgaacttcatttaggc
tcttggaaaaagaagactgatgaggaagaaggctggtattcgtattccgaaattgctgat
ttaataattgattatgtcagggaagacggatatacccatattgaaattatgccactatca
gaacatccctgtgatgaatcatggggatatcagaatactggattttttgctccaacagcg
aggtatggaacgccagatcagttgaaagagatgatagataaattacatcagtcaggtatt
ggtgttattttagattttgttccggttcattttgccattgatgcttatggattaagaaat
tatgatggcacttgtttatatgagtatccaagtacggacgtagggacaagtgaatggggt
agttataattttatatattcaaggcgagaagtaaggtgttttatgcagtcagcagctaat
tattggcttaaagagtttcattttgatggattgagaatggatgcagtaagtcgtcttatt
tattggcaaggggatgaaaaaagaggggaaaatggacaatctatagagtttcttaaagta
atgaattcaggattgaaaagtatacatccaacagcaatgcttatagcagaagattcttct
gcatatgaaggggttactagaccagtagaattaaatggattaggttttgattacaaatgg
gatttagggtggatgcatgacaccttagaatattttcaaacagcgccagaatatcgtgca
agggactatcataaactaactttttccatgctgtatttttatagtgaaaaatacctttta
gctctttcgcatgacgaggtagtacatggaaaagccactattatgcaaaaaatgagtgga
tattacgaagataaatttcctcaagcaagggctatgtacctatatatgataatgcatcca
ggaaagaaacttaattttatgggaaatgagattggacagctaagagaatggaatgaaaaa
agagaacaagattgggatattttgcaatatcccgttcatgattgttaccaccaatatact
ttaaacttaaatcaaatttataaatattatgagccattacatgatgactatagcctacat
aattttaagtggatagattgtgagcaaaatgataaatgtatttatacaatagcaagaact
ggggttaaacagacattgttagcagtttttaactttggaaatgaagattgcgaaaactat
tatataaccttaaaagaaggacaagaagtgaagttgattcttcatagtaattgggaacgc
tatagtggtactgtttcagaaactgaagaattctataaaattaatgatgaggatgatatt
attgaattatccatggaggtagccaaatttagtggtatcttatttgagataatcgattaa

DBGET integrated database retrieval system