KEGG   Clostridium cellulovorans: Clocel_3888Help
Entry
Clocel_3888       CDS       T01294                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ccb  Clostridium cellulovorans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ccb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4681257..4681748)
Genome map
AA seq 163 aa AA seqDB search
MLSIIVAKSQNHVIGKDNELIWRISEDLKRFKKLTMGNTIIMGRKTFESLPGILEGRHHI
VITRNKDYKVDNENVTVLYDINQVKNCIKEDQENFIIGGEQIYKELLPSTDKIYLTEVDR
EADGDAYFPILDEKAWIVKNQSEVFCDEKNDLQFKYVDLVRAK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtataattgtagctaaaagtcaaaatcatgttatcggtaaggataatgagcta
atttggagaatatccgaagatttaaaaagattcaagaaactaacaatgggaaacactatt
ataatgggaagaaaaacctttgaatcactcccaggcattctagaaggaagacatcatata
gtaatcactagaaataaggattataaagtagataatgaaaatgttacggttctttatgat
ataaatcaggtaaaaaactgtattaaagaagatcaggaaaattttataataggtggagag
caaatttataaagagttgcttccaagtactgataagatatatcttacagaggtggataga
gaggctgacggagatgcttatttccctatattagacgagaaagcttggatagttaaaaat
caatcggaagttttttgcgatgaaaaaaatgatctacaatttaagtatgtagacttggta
agagcaaaatga

DBGET integrated database retrieval system