KEGG   Clostridium cellulovorans: Clocel_4117Help
Entry
Clocel_4117       CDS       T01294                                 

Definition
DNA glycosylase/AP lyase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ccb  Clostridium cellulovorans
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ccb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4974240..4975070
Genome map
AA seq 276 aa AA seqDB search
MLEIPESSVLSTQISEVLRNKKIIGVISNHSPHKFAWFHGDPNEYNKILVDKTIHKATPY
GGMIEIKVESSILLFADGVSLKYNAPNEKLPPKHQLLLKFEDSSSVTASVQMYGGIWCFN
ENSDFKNPYYDIAKDKPSPLCDEFDKNYFFKLINSPDIQKLSTKSFLATEQRIPGLGNGV
LQDILWQSKLHPKRKINSLATGDKELLFINIKKVLLEMVELNGRDTEKDLFGNNGGYKTR
MSKNTVGSSCPSCDEIIEKANYLGGSIYFCPNCQKL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaattccagagtcttcagtactttcaactcagattagcgaagtattaagaaac
aaaaaaattataggtgttatatctaatcattctccacataagtttgcatggttccatggt
gatccaaatgaatataataaaatacttgtagataaaactatacataaagctacaccatat
ggtggaatgatagagattaaagttgagtcttcaattcttctatttgctgatggtgtatca
ttaaaatataatgctcctaatgaaaaacttccacccaagcatcaacttcttcttaaattt
gaggattcttcatctgttactgcatcagtccaaatgtacggtggtatatggtgttttaat
gaaaacagtgattttaaaaatccttattatgatattgctaaagacaaaccatcaccctta
tgtgatgagttcgataagaattatttcttcaagttaattaattctccagatatacaaaaa
ttgagtacaaaatcctttttagctactgaacaaagaatccctggactcggaaatggtgta
cttcaagacatcctttggcaatcaaaacttcacccgaagcgtaaaattaattctttagct
actggagataaagaactgttatttataaatattaagaaagttttattagagatggttgag
ttaaacggaagagatactgagaaagatttatttggaaataatggtgggtataaaacaaga
atgagcaaaaatacagtgggttcttcttgcccttcttgcgatgaaataatagaaaaagca
aattacttaggtggtagcatatacttctgtcctaattgccaaaagctataa

DBGET integrated database retrieval system