KEGG   Clostridium cellulovorans: Clocel_4215Help
Entry
Clocel_4215       CDS       T01294                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ccb  Clostridium cellulovorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ccb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Clocel_4215
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Clocel_4215
Enzymes [BR:ccb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Clocel_4215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5078228..5078773)
Genome map
AA seq 181 aa AA seqDB search
MAIYEFKAKTIDGEEISLDRYKGKVVLVVNTASKCGFTPQYEGLEKLYDEYKEQGLEILG
FPCNQFAEQEPGDNQEVKNFCQANYGVDFQIFEKTDVRGETAHPLFNYLTNEKPFEGFDM
KHPIGETLYNVLKEKMPSYLEGDSVKWNFTKFLVDRNGNVVKRFEPTSEPSEMEEAIKSL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcaatttatgagtttaaagctaaaactattgatggagaggaaatttcattagataga
tataagggtaaagttgttttagtagttaatactgcaagcaagtgtggatttacgccacaa
tatgaaggcttagaaaaattatatgatgagtataaagaacaaggattagaaatacttgga
ttcccatgcaatcaatttgcagaacaagaaccaggggataatcaagaggttaaaaatttc
tgccaagcaaattatggggttgattttcaaatttttgaaaaaactgatgtaagaggagaa
acagcacatccactatttaattatttaactaatgaaaagccatttgaagggtttgatatg
aagcacccaattggagaaactttatacaacgtacttaaagaaaagatgccttcttattta
gaaggggattcagtaaaatggaattttacaaaatttcttgttgatagaaatggaaatgtt
gtaaaaagatttgaaccaacatcagaaccatcagagatggaagaagctataaaaagctta
ttatag

DBGET integrated database retrieval system