KEGG   Campylobacter coli CVM N29710: G157_08215Help
Entry
G157_08215        CDS       T02838                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ccc  Campylobacter coli CVM N29710
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ccc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ccc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1623076..1623831)
Genome map
AA seq 251 aa AA seqDB search
MQRIVVKVGSHVISDENLLNLKRFENLVAFLTKLMQKYEVILVTSAAISAGCTKLHIDRK
NLINKQVLAAIGQPFLISVYNEFLAKFGKMGGQILLTGKDFDSRKATKHAKNAIDAMIDL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFEADLLVILSDIDGFYDKNPSEFSDAKR
LERVEFIKEEWLNVSVKTGSEHGTGGIVTKLKAAKFLLENHKKMFLASGFDLSVAKAFLL
ENKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatagttgtaaaagtaggctctcatgtgatcagcgatgagaatcttttaaat
ttaaagcgctttgagaatttggtggcttttttgaccaaattaatgcaaaaatatgaagtt
attttagttacttcagctgctatttcagcaggatgtaccaagcttcatatagatagaaaa
aatttaattaataaacaagttttagctgcgataggacaaccttttttaatcagcgtttat
aatgaatttttagccaaatttggcaaaatgggtggacaaattttgcttacaggaaaagat
tttgattcaagaaaggcgactaagcatgctaaaaatgctattgatgcgatgattgattta
ggaattttgcctattattaatgaaaatgatgccacagctattgaagagattgtttttggt
gataatgatagtttaagtgcctatgcgacgcatttttttgaagctgatttgcttgtgatt
ttaagtgatattgacggtttttatgataaaaatcctagtgaatttagcgatgcaaagcgt
ttggaaagggttgaatttatcaaagaagaatggcttaatgtgagtgttaaaacaggaagc
gagcacggaacaggcggtatagttactaagctaaaagcagctaaatttttattagaaaat
cataaaaaaatgtttttagcaagtggttttgatttaagtgttgcaaaggcatttttgcta
gaaaataaacaaataggcggaactttatttgagtga

DBGET integrated database retrieval system