KEGG   Clostridium cellulolyticum: Ccel_0053Help
Entry
Ccel_0053         CDS       T00835                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cce  Clostridium cellulolyticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ccel_0053
Enzymes [BR:cce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ccel_0053
Exosome [BR:cce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccel_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(60279..62507)
Genome map
AA seq 742 aa AA seqDB search
MRKIYAETATSIINGECKDPHSYLGMHLLGVEGKNLQTVVRAFQPTAKMVELVDVSAGTS
FPMKMECGNGMFEIIFPDRCDIFEYQLKITDLSGNSFITHDPYSFWPVISEFDTHLFNQG
NHHRIYEKLGAHVMTHNNVNGTLFAVWAPCAKRVSVVGDFNQWDGRRHQMRELGSSGIWE
LFIPLTSEGDLYKYEIMTPDGSLIFKADPYAYYAEKRPATASIVMNIDNYSWGDTQWMAQ
REENDVFNCPMSIYELHPGTWSTSGEPDENGDIYLNYRVIADRLVPYIKYMGYTHIELLP
VAEHPYDGSWGYQVTGYYAVTSRYGKPEDFMYFVDKCHQNDIGVLLDWVPAHFPKDAHGL
ARFDGTALYEHEDPRQGEHPEWGTLVFNHGRNEVRNFLISNAVFWFEKYHIDGLRVDAVA
SMIYLDYAKKPGQWIPNKYGGNLNLEAADFLKQLNTTVFGYFKGIIMVAEESSSWPMITK
PPYMGGLGFTFKWNMGWMNDFLKYINMDPIYRKYHHHLITFSLMYAFTENYILVLSHDEV
VHGKYSMLSKQPGDYWQKFAGLRATYGYTYGHPGKKLLFMGGEYGQFIEWNDKKGLDWHL
LDYEMHKKLQTYVKDLNTLYRESKALYEVDLSYDGFEWIDCNDNDHSVVSFIRKGRDYHD
MLIFVCNFTPAVNYNYCIGVPFDLEYELVMNSNYEKYGGYDPDDSNKIYTAISDSLHGRP
FKLCLTIPSFGVLIFKPIFKDS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatttatgctgaaacagctacaagtattataaacggtgaatgtaaagatcct
cattcatacctgggtatgcaccttttgggtgtagaaggtaagaaccttcaaaccgttgtc
agagcttttcaacctaccgcaaaaatggttgagcttgtggatgtatccgcaggcacttca
tttcctatgaaaatggagtgcggcaatggaatgtttgaaataatattcccggacagatgt
gacatttttgaatatcagctaaaaataacagatctgtccggaaatagttttattactcat
gacccttacagcttctggcctgttatatccgaatttgacacacatctctttaatcaaggc
aatcatcacagaatttatgaaaagctcggtgcacatgttatgacccataacaatgttaat
ggaacactttttgcggtttgggccccatgtgctaagcgagtgagtgttgtaggagatttt
aatcaatgggacggacgaagacaccagatgcgtgaactgggttcctccggaatatgggaa
ttatttatcccccttacttctgaaggggacttatacaaatatgaaattatgactcctgac
ggcagtctgatttttaaagccgacccatatgcatattacgctgaaaaaaggcctgcaact
gcttcaattgttatgaatatagacaattattcctggggtgatactcaatggatggctcaa
cgggaagaaaatgatgttttcaattgcccaatgtctatatatgagcttcaccccggcact
tggtcaacctccggagaacctgacgaaaacggagacatatacctgaattacagagttatt
gctgatagacttgtcccatatataaagtatatgggatatactcatattgaactattgcct
gttgcagagcatccttatgacggttcatggggatatcaggttacagggtattatgcggtc
acgagccgttacggaaaacctgaagacttcatgtattttgtagataagtgccatcagaat
gatataggagtgttattggactgggttccggcacattttccaaaagacgcccatggcttg
gcacgttttgacgggactgccttatatgaacatgaagatccaagacagggggaacatccc
gaatggggaacgctggtattcaaccatggaagaaatgaggtaaggaattttctcatttca
aatgctgtattctggtttgaaaagtatcatattgacggtttaagagtagatgctgttgca
tctatgatttatctggactatgccaaaaaacccggacagtggataccaaacaaatacggg
ggaaatctgaaccttgaggctgcggactttcttaaacagctcaacaccaccgtttttgga
tattttaagggtattataatggtcgccgaggagtcctcttcatggcctatgataacaaag
cctccatatatgggaggtcttgggtttacctttaaatggaatatgggctggatgaatgat
ttccttaagtatataaatatggatcctatttataggaaatatcatcaccatcttataact
ttttcattaatgtacgctttcactgaaaattatattcttgtgctgtctcatgacgaggtt
gtacatggcaaatactctatgctgagtaaacaacccggagactactggcagaaatttgca
ggactaagggctacctatggttacacttatggtcacccgggtaaaaagcttttatttatg
ggcggcgaatatggacagttcatcgaatggaacgataaaaaaggtctggactggcatctg
ttggattatgaaatgcataaaaaattacaaacctatgtcaaggatttgaatactttatat
agagaaagcaaggctttgtatgaggtagatttgagctatgacggatttgagtggatagac
tgcaacgataatgaccacagtgtggtctccttcataaggaagggcagggactatcacgat
atgcttatatttgtttgtaactttacacctgcggtaaattataattattgtatcggtgtt
ccctttgaccttgaatatgagcttgttatgaacagtaactatgaaaagtatggcggctat
gaccccgatgactcaaataaaatatatacggcgattagcgattccctgcatggaaggccc
tttaagctttgccttacaataccgtctttcggcgtgcttatttttaaaccaatttttaaa
gactcctga

DBGET integrated database retrieval system