KEGG   Clostridium cellulolyticum: Ccel_0089Help
Entry
Ccel_0089         CDS       T00835                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cce  Clostridium cellulolyticum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cce03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
103985..106426
Genome map
AA seq 813 aa AA seqDB search
MAISQFQQQRWSFESYPVGTNLNIIGRFDFKIYENSENGYKIYTFDIEKIIDDDGFEHEV
ADQISVTGYYEVNEHCAVLPSKIRGSVAAYKGEKQLKAETVEFIEPATDEGIISFLSCGI
IKGVGEKTARNIVSGYKSGSNYVEGFGSNTLEVIKNEPLLLTKIRGISPDKARVIHDSYM
ENMEYQNVMIFFQRFGVSSAKAMKIYNNFKGTSIAIAEQNPYMFADIRGFGFKSCDEIAR
KLGIDPHSVFRLEAALKSVLQTAEADGNCYLLKAKLLEMTAKALSNPDVTVTTDELEDAY
NRMLKSGSLVNITFSEDQQSFEAVYTKEMYKIEYETALAIKEIARCQPDVPMFSVDKLIE
EFEAMRGFNLESMQKEAVKAVFNTNMLILTGSAGSGKTTTVECMIYVLQRYFEKQEEMSF
MLAAPTGKAAKRLTEITGFEAMTLHRLLQFSYENKGFFYRQGNELPYDLIVVDESSMLSI
DLAHALFTAISPGTTVVLIGDTQQIPSVGAGNVLDDMIKSGVIPTVKLNVIKRQEDGSGI
IFNANRIINGEMPEIINANKDFFIVEEDDKNRVIKRTLEALNRLMTGYNYTIDDVQVICP
QKTSELGTYEMNKAIQEMVNPAAAGKAEVKRGNSVFRQGDKVIHLNNNYEATHYHKDAKT
GRYIADEGSGVFNGDIGRIIEISKIGEIDQESEDGEAAGDNNTEEKVAVQYDEFIIIYQI
NELEEIDLAYSLTVHKMQGSQCEAAIFLCHLRNYIMLNRNLGYTAVTRAKRMACIIGQRK
AISVMVQNVKVTQRNTMLADLLSLKMIDPNTTS
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggcaatttcacaatttcaacaacaaagatggtctttcgaaagctacccggtaggcaca
aatctaaatataatcggaagatttgattttaaaatatatgaaaattcggaaaacggatat
aaaatttatacctttgatatagagaaaattatagatgatgatggctttgagcatgaagtt
gctgaccagattagcgtaaccggttattatgaggttaatgagcactgtgctgtactgcca
agcaagataaggggttcagtggctgcctacaaaggagaaaaacagcttaaggctgaaaca
gttgaatttattgaacctgctacggatgaaggtattatttctttcttgtcctgcggaatt
ataaagggtgttggagaaaagacggcaagaaatattgtgtcaggctataaatcaggttca
aattatgttgaaggctttggaagcaatactttggaagtgataaaaaacgaacctttgctg
cttactaaaataagaggaatttcaccggataaagccagagtaattcacgactcctatatg
gaaaacatggaatatcagaatgttatgattttctttcagaggttcggagtttcctctgcc
aaagctatgaaaatttacaataactttaaaggcacttccattgccatagccgaacagaat
ccctacatgtttgctgatataagagggtttggttttaaaagctgtgatgaaattgccaga
aagcttgggatagacccacactcagtattcagacttgaagcagctcttaaaagtgttctt
caaacagcagaggctgacggaaattgttatttgctcaaagctaaacttcttgaaatgact
gcaaaggctttaagtaatccggatgttacggtaactactgatgaactggaagatgcctat
aatagaatgcttaaatcgggcagtctggttaatataactttttcggaagaccagcaaagc
tttgaggcagtgtacacgaaggaaatgtataaaattgagtatgaaactgctttggcaatt
aaggagatagcccgctgccagcctgatgtgcctatgtttagcgtagacaaacttattgaa
gaatttgaagctatgaggggctttaatcttgaaagtatgcagaaggaagcagtaaaagcg
gtttttaatacaaatatgcttattcttaccgggtcagccgggagcggcaaaaccactact
gttgaatgtatgatctatgttttacagagatattttgaaaaacaagaagagatgagtttc
atgttggctgcaccgactgggaaagcggccaaaagactcacggaaatcactggttttgaa
gctatgactctgcacaggcttctgcaattctcatacgagaacaagggctttttttacagg
cagggaaatgagctgccatatgatttaattgtagtggatgaaagctccatgctaagcata
gacctagctcatgcactgtttacggctatttcgcctggcacaacagtagtacttattggg
gatacccagcagattccgtctgttggtgcaggcaatgtacttgatgacatgattaagagc
ggagttatacctaccgtcaagctcaatgtaataaagcgtcaggaagacggctcaggtata
attttcaatgcaaataggattattaatggtgaaatgcctgaaataattaacgccaacaag
gattttttcatagttgaagaggatgataaaaacagagttataaagaggactcttgaggcg
ttgaacagattgatgacaggctacaactacactattgacgatgttcaagttatttgccct
caaaaaacttcggaattaggcacctatgaaatgaataaggccattcaggagatggtaaat
ccagctgctgccggaaaggctgaagttaaaagaggtaacagtgtattccgtcaaggtgac
aaagtaatccatttaaacaataactatgaagctacccactaccacaaagatgctaaaaca
gggaggtatatcgcggatgaaggcagtggtgtatttaacggagatataggaagaataatt
gaaatttctaaaataggagaaattgatcaggagtcggaagacggggaagctgccggtgac
aataatactgaggagaaggtggctgttcaatacgatgaatttattattatatatcagata
aatgagctagaggagatagatctggcatacagccttaccgtgcataagatgcaaggctcg
caatgtgaagcggcaatatttttatgtcacctacgaaattatataatgctaaatcggaat
ttaggctatacggctgtgacaagggcaaagagaatggcatgcataataggccaaaggaaa
gctatatctgttatggttcaaaatgtgaaagttacacaaaggaatacaatgttagctgat
ttactatctttgaagatgatcgatccaaatacgacttcctag

DBGET integrated database retrieval system