KEGG   Clostridium cellulolyticum: Ccel_0280Help
Entry
Ccel_0280         CDS       T00835                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cce  Clostridium cellulolyticum
Pathway
cce00520  Amino sugar and nucleotide sugar metabolism
cce00550  Peptidoglycan biosynthesis
cce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ccel_0280
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ccel_0280
Enzymes [BR:cce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Ccel_0280
Peptidoglycan biosynthesis and degradation proteins [BR:cce01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Ccel_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ACL74667
JGI: Ccel0280
UniProt: B8I587
Position
317817..319079
Genome map
AA seq 420 aa AA seqDB search
MAKYVISEGVPLRGSVRVDGAKNAVLPIIAASLLSESKSIIEEVPDLNDVRIMCDLLRCL
GTDVQKQSDPTTISFETKEITNSTAPYELVNKLRASFLVMGPMLARTGYVRVALPGGCPI
GSRPVDLHLKGFSALGAEITQGHGYIEARKNKKLVGNKIYLDFPSVGATENIMMAAVMAE
GQTIIENAANEPEIVDLASYLNEMGAIVVGAGTDTIRIEGVTSMKGCTHTVIPDRIEAGT
FMIAAAITNGEVRIENVVPDHLKPVVAKLKETGLEISEELSAITVKSIGGLKPIDVKTLP
YPGFPTDMQAQVTSMLSCIPGTSMVIETIFENRFMHISELKRMGANIKIDGRTAVIEGKP
CLTGACVKATDLRAGAALVLAGLAAEGATEISEIQHIDRGYSGFAEKLKSLGAKITRVED
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaatatgtgatcagtgaaggtgtgcctttaaggggcagtgtaagagtagatggt
gcaaaaaatgcggttcttccaataatagcagcatccctgctaagcgagtcgaagagtata
attgaagaagtacccgacctaaacgatgtcaggataatgtgtgatttattaagatgtctg
ggtaccgatgttcagaagcaatctgaccctaccaccatatccttcgaaactaaagaaata
acaaattcaacagcaccctatgagctggtaaataagctaagagcatcttttctggtcatg
ggtcctatgcttgccagaacagggtatgtacgggttgctttgccgggaggatgccccata
ggttcaaggcctgttgatttacacttgaaagggttttccgctctaggtgctgaaataact
caagggcatggttatatcgaagccagaaaaaataaaaagcttgtgggaaacaagatttat
cttgattttcccagtgtaggtgcaactgaaaacattatgatggctgctgtaatggcggaa
ggtcagacaataatagagaatgctgccaatgagccggaaatagtggatttggccagctat
ctcaacgaaatgggagcaattgtcgtaggagcaggaacagacaccatcaggatagaagga
gttacaagtatgaaaggctgtacccacacagtaattccagaccgcattgaggctggtaca
tttatgatagccgctgccattaccaacggtgaagtcagaattgaaaacgttgtaccagat
caccttaaacccgtagttgcaaagctaaaagaaacgggtttggagatttcagaagaattg
tctgcaataacagtaaaaagtataggcggactaaaacccatagatgtgaagacactgccc
tatccgggctttcccactgatatgcaggctcaagtaacgtcgatgctttcctgtattccg
ggtacaagtatggttatagaaactatatttgagaacaggtttatgcacataagtgaattg
aagcgaatgggtgcaaacataaagatagatggaagaacagctgtaattgaagggaaacca
tgtcttacaggagcatgtgtcaaagcaacagacctgagggcaggtgcggcactggtacta
gcgggccttgcggcagagggagcaactgaaataagtgaaatacagcatatagacagggga
tattcggggtttgcagaaaagctgaaatctcttggggcaaaaataacaagggttgaagat
taa

DBGET integrated database retrieval system