KEGG   Clostridium cellulolyticum: Ccel_0479Help
Entry
Ccel_0479         CDS       T00835                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cce  Clostridium cellulolyticum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cce00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cce00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
549160..550620
Genome map
AA seq 486 aa AA seqDB search
MKLRELVMNLNIKAINGNLDVEVDSIAYDSRKTKQGSLFVCIEGTVVDGHKYINDAIENG
TKAFLVQKHVVVPEGITTIEIDDTRFGLAAVSDAFFGHPSSKFNLIGITGTKGKTTTTYM
VKAIMEAAGRNMGLVGTLANLIGSEVLYTSRTTPESYDLQSLFSDMVEKKVDSTVMEVSS
QGLELHRVAKCDFDIGVFTNFSRDHIGPKEHATLEEYFNAKAKLFKMCRKAVINIDSEHG
RKMAELAKCKVFTYGLSDKADIWASDIVKKTGHTYFTLNSPWGSIDIETDLQGEFNIYNA
LAAIGSCCLIPGITLEHVRLGLTKVTVPGRMESVKTGGNYSVLIDYAHTPDSLEQVLKTV
KEFAHGRVVSLFGCGGDRDKGKRPAMGEISGNIADFTIITSDNPRTENPEQIIEDIEAGI
KNTNGKYIKITDRRQAIKFALENAVDGDIIILAGKGHETYQQFAEKTIHFDEREVVNELL
IELGRR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctaagagagcttgtaatgaatttaaatatcaaggcaattaatggaaatctggat
gtggaagttgacagtatagcatatgattccagaaaaacaaaacagggcagtctttttgtt
tgtatagaaggaactgttgttgacggacacaagtacataaatgatgctatagaaaacggg
acaaaggcgtttctcgttcagaagcatgtagtcgtacctgaaggaattacaactattgaa
atagatgatacaagatttggacttgcagctgtatctgatgcattttttggtcatccttca
tcaaaattcaatctgataggcattacagggacaaaaggtaaaactacaactacttatatg
gttaaggctatcatggaggctgcaggacgtaatatgggccttgtagggactcttgccaac
ctaataggaagtgaggtgctgtatacctccagaactactcccgaatcatatgatttgcag
agcctcttcagtgatatggttgaaaagaaggtggacagtacagttatggaagtatcgtcc
cagggactggagctgcatagggttgcaaaatgtgattttgatataggagtgtttacaaat
ttttcaagagatcatatcgggccaaaggaacatgcaacacttgaagaatacttcaatgca
aaagcaaagctgtttaaaatgtgccgtaaggcagttattaatatagacagtgagcatggc
agaaaaatggcagaactagcaaaatgtaaggtgttcacatacggcttaagcgacaaagcc
gatatatgggcttctgatatagttaagaaaacaggacacacatactttacactcaattct
ccatggggtagtattgacattgaaacagatttacagggtgaattcaatatatacaacgca
ttggcggctattggttcctgctgcttgatacctggtattacccttgagcatgttagatta
ggactgacaaaggttacggttccgggtagaatggaatctgtaaagaccggcggcaattat
tctgttctcatagattatgcacatactcccgacagtcttgaacaggtacttaaaacagtt
aaggagtttgctcatggcagggttgtcagcttgtttgggtgcggaggagacagagataag
ggaaagagacctgcaatgggtgaaatttcaggaaatattgctgattttacaattataact
tctgataatccgagaaccgaaaaccctgaacagataatagaagacattgaggcaggcatt
aaaaacacaaacggaaaatatattaaaataaccgatagaaggcaggcaataaaatttgca
cttgaaaatgccgtggatggagatataattattttggcaggtaagggtcatgagacctat
cagcaatttgccgaaaaaacaatacactttgatgaacgtgaagtagtaaacgagctgctg
atagaactcggaaggagatag

DBGET integrated database retrieval system