KEGG   Clostridium cellulolyticum: Ccel_0930Help
Entry
Ccel_0930         CDS       T00835                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cce  Clostridium cellulolyticum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ccel_0930
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ccel_0930
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ccel_0930
Enzymes [BR:cce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ccel_0930
Exosome [BR:cce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccel_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1104725..1106338
Genome map
AA seq 537 aa AA seqDB search
MIKKALSSKRLFTGLLCLTMAMVLALGTAFSSANESNSGMQNRAVASSTAEAALKATATT
TKTPKYIFMFIGDGMAAAQVNLAQIYKGNNKHNQISLKELSFQDFEAVGYQTTHDATSFA
PDSASTATSLSSGFKTWSGTIGLKPVGNKSGNKPENVNSSNIPQTIAERLKAEKGMKVGI
ISTVTINHATPAAFYAHVPSRNDYYDIAMQMAKSNFDYFGGGTINQPTGPKKDQKDAYEV
MKQNGYTIAKTKKDILALNSKSGKVYAITPVVQDSGAMPYAIDNKAGDLTLADFVKKGID
VLDNEKGFFMMTESGKIDWAGHANDAKANIGDVLAFDNAIQVAINFANKHPDETLIIVTG
DHETGGMTIGQATTGYDTAFELLDHQKMSYVAFDNLINEMKAKNPKLSFNKVLSVITENF
GLVNETTGDISRKGEPSYMTLELSDREMSKLKTAFAETMAEEPTDNEETDLLYGGYNPLS
VTLTHILNNKAGIGWASYSHTGVPVPVYATGAGAELFNGAYENTDVYNKLVKITDLK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcattgtctagtaagagattattcacaggtttactatgtttaacaatg
gcaatggtattggcgttggggacagctttttcatccgctaatgagtcaaattcaggcatg
caaaatcgagcggtggcatcaagtacagcagaagctgcactaaaagcaacagcaactaca
acaaagactccaaagtacatatttatgtttatcggggacggtatggcagcagctcaagta
aacttagctcaaatttacaagggaaacaataaacataatcaaatatccttaaaagaactt
agctttcaggattttgaggcagtgggatatcaaacaactcatgatgcaacatcttttgct
ccggattccgcatctactgcaacctcgttgtcatcaggatttaaaacctggagtggaact
attggattgaagccggtaggaaataaatcaggtaataaaccagaaaatgttaatagctct
aatattcctcaaactatagctgaaagactaaaagcagagaagggtatgaaggttggaatc
atatcaaccgtaacaattaatcatgctacaccggcagctttttatgcacatgtaccttca
aggaatgattattatgatatagctatgcaaatggctaaatcaaactttgattattttggt
ggtggtactataaaccaaccgacaggaccaaaaaaggatcaaaaggatgcttacgaagtg
atgaaacaaaacggatatacaatagcaaaaacaaagaaagacattttagcccttaacagc
aaatcaggaaaagtgtatgccataactcctgtggttcaagatagtggtgctatgccgtat
gcaattgataataaagcaggcgatttaactctcgctgattttgttaagaagggcatagat
gttcttgataacgaaaaaggatttttcatgatgactgaatcgggaaagattgactgggca
ggtcacgctaacgatgcaaaagcaaatatcggtgatgttttagcatttgataatgctatc
caggtagctataaattttgctaataagcatccggatgaaacattaataatagtaacaggc
gaccatgaaacaggtggtatgactataggtcaggcaacaacaggatatgatacagctttt
gaacttttagatcaccaaaagatgtcttatgttgcattcgataatttgattaatgagatg
aaagccaaaaatccaaagttatcatttaacaaagtactttctgtaattactgagaatttt
ggtcttgttaatgaaactacaggtgatattagccgtaaaggtgagcccagttatatgaca
ttagaattgtcagatagagaaatgtcaaaactcaaaactgcttttgctgaaacaatggca
gaagaacctactgataatgaagaaaccgatttattatacggtggttataatccactttca
gtaacattaactcatattttaaataacaaagcgggcataggctgggcatcatattcccac
acaggagttccagtgccggtatatgcaacaggtgcaggagcagagctgttcaatggtgca
tatgagaacactgatgtatacaacaagttggtaaaaattacagatcttaaataa

DBGET integrated database retrieval system