KEGG   Clostridium cellulolyticum: Ccel_0931Help
Entry
Ccel_0931         CDS       T00835                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cce  Clostridium cellulolyticum
Brite
Enzymes [BR:cce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Ccel_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1107142..1108413
Genome map
AA seq 423 aa AA seqDB search
MRKNSFKSLAVALSVLLTALMVCSSMVSAATPTGKRLKDVQSRVLVGTEFSSGFTNMDST
FFNTATPEFNLVTAENCMKWDALEPSQNSFNWNEADKLMNWAKTNNYKVHGHTFVWHNQA
PGWIQNLSASAMESAMNNHIDKVMGRYKGQIPIWDVANEVFEENGSYRNSFWYRTMGKSF
IEKAFIRARAADPSAKLVYNDYNLEYTGPKSNAAYEMLKDFKSRGIPVDGIGFQMHLDIQ
YAIDYNDFAKNMQRFADLGLEIYITEMDVRVSSNTNSTELQTQASYYKNIIEKCMAQPAV
KAIQFWGFTDKYSWVPGTFSGRDNALLFDKNYNPKPAYYAVQAALATSPTPTVIYGDLDG
SGSVDALDYSLMKQYLLGSITKFPSENGLVAADVNASGTVDALDFAVMKQYLIGLITKFP
AQV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacagttttaaatcgttagcagtggcactttctgtcttactgacagctttg
atggtttgttcatctatggttagtgccgctactcccacaggtaaaaggttaaaagatgtt
caaagcagggttctggtaggaaccgaattctctagtggttttactaacatggattccaca
tttttcaacactgctactccagaatttaatctggtaacagcagaaaattgtatgaaatgg
gatgctttagaaccttcacaaaatagttttaactggaacgaagcagataaactcatgaac
tgggcgaaaactaacaattataaggttcatggacatacgtttgtttggcacaatcaagct
ccaggttggatacaaaatcttagtgccagtgctatggagtctgccatgaacaatcatatt
gacaaggtaatggggcgttataaaggccagattcctatttgggacgtagctaatgaagtt
tttgaggaaaacggaagctacagaaattccttctggtatagaactatgggtaagagcttt
attgagaaagcatttatccgtgctcgtgctgctgacccttctgccaaactggtatacaac
gattacaatcttgagtataccggacctaagtccaacgccgcctatgagatgctcaaagac
tttaaaagccgtggtatacctgtagatggtattgggttccagatgcacctagatatacaa
tacgcaatcgactataatgacttcgctaagaatatgcaacgttttgcagatttaggcctt
gagatatacataactgagatggatgtacgtgtatccagcaatactaattcgactgaactt
caaactcaagcaagctactacaagaatatcatcgagaaatgtatggcacagcctgctgta
aaggctatccagttttggggcttcacagataaatattcttgggtacccggaacattctca
ggcagagacaatgctttactcttcgataaaaactataatccgaaaccagcttattatgca
gtgcaagcagctctcgctacatctcctacaccaacagtaatatatggtgaccttgatggc
agtggcagtgttgatgctttagattattcacttatgaagcaatatctgttgggttcaata
accaaattcccatctgaaaatggtttggttgctgcagatgtaaatgccagcggaacagta
gatgcactggatttcgctgttatgaaacaatatctgattggccttataaccaaattccct
gcccaagtgtaa

DBGET integrated database retrieval system